(data stored in ACNUC7421 zone)

EMBL: CP001700.PE58

CP001700.PE58        Location/Qualifiers
FT   CDS_pept        59678..60886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0058"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   sgr:SGR_6775 putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69013"
FT                   /db_xref="GOA:C7QH74"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH74"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACU69013.1"
FT                   /translation="MQPPEHLAYTPAQRALRAELRTYFAALVTEEVHRDLRLPDTATDT
FT                   ARTLHRKLGADGWLGVGWPQEYGGRGLTPVEQFIFFDEAARAGCPMPLVALNTVGPTLM
FT                   RFGTQEQKDLLLPGILAGEIDVAAGYSEPGAGTDLASLTTRAVLTEDGSAYAVNGQKIF
FT                   TTHGDSAEYVWLACRTDPDAPKHKGISILLVDTKDPGFEATKIHTIASHYTTATYYRDV
FT                   RVPVTMRVGAENAGWKLITTQLNHERVALAAVAQGVIRSFAKVQSWAMETPAADGKRVI
FT                   DLPWVKTTMARAYIRISGLRLLNGQMVAALQKDQTGGHLSPADASAAKVHGTETHIEAL
FT                   AELIQVLGAGGILKTGSPGALLAGDLEYLYRWAVTNTFGGGANEIQREIIAMTGLAMPR
FT                   VRR"
     atgcagccac cggaacacct ggcctacacc ccggcccaac gagccctgcg agccgagctg        60
     cggacgtatt tcgccgcact ggtcaccgag gaggtccacc gcgatctgcg cctgcccgac       120
     accgccacgg acacggcccg caccctgcac cggaagctcg gcgcggatgg ctggctcggc       180
     gtgggatggc cgcaggaata cggcggccgc ggtctgacgc cggtcgagca gttcatcttc       240
     ttcgacgagg cggcgcgcgc cggctgcccg atgcctctgg tggcgctcaa cactgtgggc       300
     ccaacgctta tgcgtttcgg tacgcaggaa cagaaggact tgctgctacc ggggatcctc       360
     gccggggaga tcgacgtcgc ggccggctac tccgagcccg gcgccggcac ggacttggcg       420
     agtctgacca cacgcgctgt gctcaccgag gacggcagcg cttatgcggt caacggacag       480
     aagatcttca cgacgcacgg agactcagcg gagtacgtct ggctcgcctg ccggaccgat       540
     ccggacgcgc cgaagcacaa gggcatttcc atcctgctgg tcgacaccaa ggatcccggg       600
     ttcgaggcga cgaagatcca caccatcgcc tcgcactaca cgaccgccac gtactaccgc       660
     gacgtccgtg tcccggtcac gatgcgggtc ggcgcggaga acgcgggctg gaagctgatc       720
     accacccagc tgaaccacga gcgggtggca ctggctgcgg tcgcgcaggg agtgatccgc       780
     tcgttcgcga aggtgcagag ctgggccatg gagacacctg ccgcagacgg gaaacgggtc       840
     atagatctgc cctgggtgaa gaccactatg gcgcgcgcct atatccgcat cagtggtcta       900
     cggcttctca acggccagat ggtcgccgca ctgcagaagg accagaccgg tggccacctg       960
     tcccccgcag atgcgtccgc agcgaaggtg cacggtacgg aaacgcatat agaggcgcta      1020
     gcggagttga tccaggtact cggcgcagga ggaatcctga agacgggatc ccccggcgcg      1080
     cttctggccg gcgacctcga atacctctac cgctgggcgg tgaccaacac cttcggcggc      1140
     ggcgccaacg agatccagcg ggagatcatc gcgatgaccg ggctggcgat gcccagggtg      1200
     cggagatag                                                              1209
//

If you have problems or comments...

PBIL Back to PBIL home page