(data stored in ACNUC7421 zone)

EMBL: CP001700.PE59

CP001700.PE59        Location/Qualifiers
FT   CDS_pept        60895..61416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0059"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: msm:MSMEG_5992 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69014"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH75"
FT                   /inference="similar to AA sequence:KEGG:MSMEG_5992"
FT                   /protein_id="ACU69014.1"
FT                   /translation="METDPLYETVSAHIADPPSEPVPAWDPVNQPMIRHWCDAMGDDLP
FT                   IYTDAAAARAAGHPDVVAPPASLQAWTMPGLRMRGFEDGTTRAQAMLVEAGYRAVVATD
FT                   CEQTYHRYLTIGDHLYATSRLDSVSPRKKTALGEGYFLTSVTEYRDQRGELLGEMLFRT
FT                   LWFKPKEPAA"
     gtggagaccg atccgctgta cgagacagtg tccgcccaca tagccgaccc gccgtccgag        60
     ccggtcccgg cctgggaccc ggtgaaccag ccgatgatcc ggcactggtg cgacgcgatg       120
     ggcgacgacc tgccgatcta caccgacgcg gcggcggcgc gcgcggcagg gcaccccgac       180
     gtggtcgcac cgccggcgtc gttgcaggcc tggacgatgc ccgggctgcg gatgcgcggg       240
     ttcgaggacg ggaccacccg ggcccaggcc atgctggtcg aggcgggcta ccgggccgtg       300
     gtggcgaccg actgcgagca gacctatcac cgctacctca ctatcggaga ccatctgtac       360
     gccacctcgc ggttggactc cgtgtccccg cgtaagaaga cggcgctcgg tgagggctac       420
     ttcctgacgt cggtcacgga gtaccgcgac cagcgcggcg aactgctcgg cgagatgctg       480
     ttccggacgc tgtggttcaa gcccaaggag ccggcggcat ga                          522
//

If you have problems or comments...

PBIL Back to PBIL home page