(data stored in ACNUC7421 zone)

EMBL: CP001700.PE6

CP001700.PE6         Location/Qualifiers
FT   CDS_pept        7225..9210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0006"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.6.2.3"
FT                   /note="KEGG: sma:SAV_4321 DNA gyrase subunit B; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA topoisomerase type IIA
FT                   subunit B region 2 domain protein; DNA gyrase subunit B
FT                   domain protein; TOPRIM domain protein; ATP-binding region
FT                   ATPase domain protein; SMART: DNA topoisomerase II;
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68961"
FT                   /db_xref="GOA:C7QFM2"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFM2"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ACU68961.1"
FT                   /translation="MADVEPTGGSTPSLDGIYNADSISVLEGLEAVRKRPGMYIGSTGE
FT                   RGLHHLVYEIVDNSVDEAMAGYADTIEVWLLADGGVKVVDNGRGIPVGINTKTGKSALE
FT                   VVMTILHAGGKFGDGGYKVSGGLHGVGVSVVNALSSRVEVEVHTDGFVWNQVYKHGVPE
FT                   TEVQKGGPAADTGTSTIFWADVDIFETTVYSFETLSRRFQEMAFLNKGLTISLTDERPE
FT                   FRDENGEQRSVKYHAEGGIADFVRHINSRKGEPVHPNVIDFEGEDKDRTLAAEIALQWN
FT                   SQYSESIYTFANNINTHGGGTHEEGFRAALTTLINKYARDQKLLKEKDDNLAGEDIREG
FT                   LTTIVSVKLAEPQFEGQTKDKLGNPEAKTFVQRLVYEKLGEWLEENPNEAREVIRKTIQ
FT                   ASTARMAARKARELTRRKGLLESSSLPGKLSDCQSNDPTKTEIFIVEGDSAGGSARSGR
FT                   DPMTQAILPIRGKILNVEKARIDKVLQNTEVQALISALGTGVHDDFDISRLRYHKIILM
FT                   ADADVDGAHINTLLLTLLFRFMKPLVEAGHVYLAAPPLYKVKWTNNDFNYAYSDRERDQ
FT                   LLEAGVGAGKRRKDETVQRFKGLGEMNAEELRITTMDREHRILRQVTLDDAAQADDLFS
FT                   VLMGEDVEARRNFIQRNAKDVRFLDI"
     gtggcggacg tagaaccgac cgggggtagc accccaagcc tcgatggcat ctataacgct        60
     gactccatca gtgtcctgga ggggttggaa gccgtccgga aacggccggg catgtacatc       120
     ggatccaccg gggagcgcgg cctgcaccac ctggtgtacg agatcgtcga caactccgtg       180
     gacgaggcga tggccggcta cgccgacacc atcgaggtct ggctgctcgc cgacggcggc       240
     gtgaaggtcg tcgacaacgg ccgcggcatc ccggtcggca tcaacaccaa gaccggcaag       300
     tccgcgctgg aagtcgtgat gacgatcctg cacgccggcg gcaagttcgg cgacggcggc       360
     tacaaggtct ccggcggtct gcacggcgtc ggcgtctcgg tggtgaacgc gctgtccagc       420
     cgggtcgagg tcgaggtgca caccgacggc ttcgtgtgga accaggtcta caagcacggc       480
     gtgcccgaga ccgaggtgca gaagggcggc ccggccgccg acaccggcac ctccacgatc       540
     ttctgggccg acgtcgacat cttcgagacc acggtctact ccttcgagac cctctcgcgc       600
     cgcttccagg agatggcctt cctgaacaag gggctgacga tctcgctgac cgacgagcgt       660
     ccggagttcc gcgacgagaa cggcgagcag cggtcggtga agtaccacgc cgagggcggc       720
     atcgccgact tcgtgcggca catcaactcc cgcaagggcg agccggtcca cccgaacgtc       780
     atcgacttcg agggcgagga caaggaccgc accctggccg ccgagatcgc cctgcagtgg       840
     aacagccagt actccgagtc gatctacacc ttcgccaaca acatcaacac gcacggcggc       900
     ggtacccacg aagagggctt ccgcgccgcg ctgacgacgc tgatcaacaa gtacgcgcgc       960
     gaccagaagc tgctcaagga gaaggacgac aacctcgccg gcgaggacat ccgcgagggc      1020
     ttgaccacca tcgtctcggt gaagctcgcc gagccgcagt tcgagggcca gaccaaggac      1080
     aagctgggca accccgaggc caagacgttc gtgcagcgcc tggtctacga gaagctcggc      1140
     gagtggctgg aagagaaccc gaacgaggcc cgcgaggtca tccgcaagac gatccaggcc      1200
     tcgaccgcgc gcatggccgc gcgcaaggcc cgcgagctca cccgccgcaa gggtctgctg      1260
     gagtcctcct cgctgccggg caagctgtcc gactgccagt ccaacgaccc gacgaagacc      1320
     gagatcttca tcgtcgaggg tgactccgcc ggcggctcgg cccgctccgg gcgcgacccg      1380
     atgacccagg ccatcctgcc gatccgcggc aagatcctga acgtggagaa ggcgcgcatc      1440
     gacaaggtgc tgcagaacac cgaggtccag gcgctgatct cggcgctggg caccggggtg      1500
     cacgacgact tcgacatcag ccggctgcgc taccacaaga tcatcctgat ggccgacgcc      1560
     gacgtcgacg gcgcgcacat caacaccctg cttctcacgc tgctgttccg gttcatgaag      1620
     ccgctggtcg aggccgggca cgtgtacctg gccgcaccgc cgctgtacaa ggtgaagtgg      1680
     acgaacaacg acttcaacta cgcctactcc gaccgcgagc gcgaccagct gctggaagcc      1740
     ggcgtcgggg ccggcaagcg gcggaaggac gagaccgtcc agcgcttcaa gggcctcggc      1800
     gagatgaacg ccgaggagct gcggatcacc accatggacc gcgagcaccg catcctgcgc      1860
     caggtcacgc tcgacgacgc ggcccaggcc gacgacctgt tctcggtcct gatgggcgag      1920
     gacgtcgagg cccgccgcaa cttcatccag cgcaacgcga aggacgtcag gttcctggac      1980
     atctga                                                                 1986
//

If you have problems or comments...

PBIL Back to PBIL home page