(data stored in ACNUC7421 zone)

EMBL: CP001700.PE60

CP001700.PE60        Location/Qualifiers
FT   CDS_pept        61413..61823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0060"
FT                   /product="protein of unknown function DUF35"
FT                   /note="PFAM: protein of unknown function DUF35; KEGG:
FT                   mpa:MAP2587 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69015"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH76"
FT                   /inference="protein motif:PFAM:PF01796"
FT                   /protein_id="ACU69015.1"
FT                   /translation="MTRPLPVTGRDNAYYWEGVAKGDVLIQKCTACGSLRHPPSPMCPD
FT                   CQSLDWTTVKATGHAVLHSYTICHHPLPPWEEGPYAVVLIDLDMEDSDARPRIVCGTRG
FT                   IANEDLRIEMPLSLVFEDGLVFAGPAQEGGAP"
     atgacgcgcc cgcttccggt caccggccgc gacaacgcct actactggga gggcgtcgcg        60
     aagggcgacg tgctcatcca gaagtgcaca gcctgtggat cgcttcggca tcctccctct       120
     cccatgtgtc cggactgcca atccctcgac tggacgacgg tgaaggcgac cggtcacgcc       180
     gtcctgcaca gctacacgat ctgccatcac ccgctgccgc cctgggaaga gggtccctac       240
     gcggtcgtcc tcatcgacct ggatatggaa gacagcgacg cacggccgcg cattgtctgt       300
     gggactcgcg gtatcgccaa cgaggacctg cgtatagaga tgccactgag tctcgtcttc       360
     gaggatggac tcgttttcgc cggacccgct caagaaggtg gggcgccgtg a                411
//

If you have problems or comments...

PBIL Back to PBIL home page