(data stored in ACNUC7421 zone)

EMBL: CP001700.PE61

CP001700.PE61        Location/Qualifiers
FT   CDS_pept        61829..62908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0061"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; Acyl-
FT                   CoA dehydrogenase type 2 domain; KEGG: sgr:SGR_3736
FT                   putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69016"
FT                   /db_xref="GOA:C7QH77"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH77"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACU69016.1"
FT                   /translation="MDQPVDDALEAIGELSSEVFKDLDIETTRSPAYSNEAVSDEHDRR
FT                   LWRILADTGLLAAVLPASVGGGGTGLPGMVRLLSDAGAALARLPLVETFVAVSVIDEKH
FT                   LPAVLSGELVITAALAEHPSTITAPLRLTGQRLNGITQLVPYPLSSDLVLVPALREDDT
FT                   EVLALVSLSTARVGDQVTTTGEPLGVLEFIDAEVMELCDAVGEARALAALFSSATLCGI
FT                   AARALAMTAEYVGGRVQFGHPLATFQGVALSAADRYIDSRAMQAALWDAVYAIAENGIS
FT                   SPRARYAIATARVWAADGARRVVGSAQHLHGGFGVDVTYPLHRYHAWARYWELYGGSAE
FT                   AWSGDLGELIAAHPIEEDQ"
     gtggaccagc cggtggacga cgcgctggaa gccataggag aactctctag cgaggtcttt        60
     aaggatctcg acatagagac cacacgaagt ccggcttata gcaacgaagc ggtatccgat       120
     gagcatgacc gtcgcctatg gcggatattg gctgacaccg gactgctcgc cgcagtactt       180
     ccggcgagcg tgggtggcgg cggtactgga ttgccgggca tggtgcgctt gctgtccgat       240
     gccggagccg cactcgcgcg gctgcctctg gtggagacgt tcgtcgcggt ctcggtcatc       300
     gatgagaagc acttgccggc cgtgctgtcg ggggaactgg tcatcaccgc ggcgctcgcc       360
     gagcatccct cgacgatcac cgcgccattg cggctgaccg gtcagcggct caacgggatc       420
     acgcaactgg tgccgtaccc cctcagctcc gacctggtgc tcgtcccggc gctccgcgag       480
     gacgatacgg aagtgctggc gctggtctcc ctgtcgacgg cgcgcgtcgg cgaccaggtg       540
     acgaccaccg gcgagccgtt gggcgtcctg gagttcatcg acgccgaagt catggagctc       600
     tgcgacgcgg tcggcgaggc ccgcgccctg gctgcgctgt tctcctccgc gacgctctgc       660
     gggatcgcag cgcgggcgtt ggcgatgacg gccgagtacg tcggcggacg cgtccagttc       720
     gggcatccgc tcgcgacgtt ccaaggcgtg gccctgtccg ctgcggaccg ctatatcgat       780
     tcccgcgcta tgcaagccgc actgtgggat gccgtatacg cgatcgcaga gaacggcatc       840
     agctcgcccc gggcccggta cgcgatcgcc accgccaggg tctgggccgc cgacggcgcg       900
     cgccgggtcg tcggatcggc gcagcacctg cacggcggtt ttggcgtgga cgtcacctat       960
     cccttgcacc gctatcacgc gtgggctcgc tactgggagc tctacggagg ctccgccgaa      1020
     gcctggtccg gcgacctcgg cgagctcatc gccgctcacc ccatagagga ggatcaatga      1080
//

If you have problems or comments...

PBIL Back to PBIL home page