(data stored in ACNUC7421 zone)

EMBL: CP001700.PE62

CP001700.PE62        Location/Qualifiers
FT   CDS_pept        62905..63306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0062"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   rha:RHA1_ro05828 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69017"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH78"
FT                   /inference="protein motif:PFAM:PF01575"
FT                   /protein_id="ACU69017.1"
FT                   /translation="MSALPKVGEALPELIIPITPTRIVSGAIASRDYQDVHHDVPAARE
FT                   KGSPDIFMNILTTNGLVGRYVTDWAGAEARILKIAIRLGVPNYPGDTMTLTGSVASVGE
FT                   DGAVEVAIRGANQLGNHVTGTVTLKGLGE"
     atgagcgcac tgcccaaggt cggggaggcg ttgccggagc tgatcatccc gatcaccccg        60
     acccggatcg tctccggcgc catcgcctcc cgcgactacc aggacgtgca ccacgacgtc       120
     ccggcagccc gcgagaaggg ctcccccgac atcttcatga acatcctcac caccaacgga       180
     ctcgtcggac gctacgtgac cgactgggcc ggcgcggagg cccggatcct gaagatcgcg       240
     atccgcctcg gcgtgccgaa ctatcccggc gacacgatga ccctcaccgg gtccgtggcg       300
     agtgtcgggg aggacggcgc cgtcgaggtc gcgatccgcg gcgcgaacca gctcggcaac       360
     cacgtcaccg gaaccgtgac cctgaaaggc ctcggtgagt ga                          402
//

If you have problems or comments...

PBIL Back to PBIL home page