(data stored in ACNUC7421 zone)

EMBL: CP001700.PE63

CP001700.PE63        Location/Qualifiers
FT   CDS_pept        63309..64481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0063"
FT                   /product="lipid-transfer protein"
FT                   /note="KEGG: nfa:nfa4530 lipid-transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69018"
FT                   /db_xref="GOA:C7QH79"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH79"
FT                   /inference="similar to AA sequence:KEGG:nfa4530"
FT                   /protein_id="ACU69018.1"
FT                   /translation="MSLAGEAAIVGIGATEFSKESGRSELQLCLEACKAALDDAGIAPR
FT                   DVDGLVTFSMDSSPSIMVGRGLGVAELRHFSLVDYGGGAACATVAHAAAAITAGLADVV
FT                   VCYRAFNERSGRRFGSGDAAIQARGESPMAQHFGYYSPYGLITPAAWVAMAARRYMHKY
FT                   GATSEDFGRVAVAARTHAATNPAAWFYERPITLADHQSSKLIADPVRLLDCCQESDGGV
FT                   ALVVVSAERARDLPGKEVLIAGAAQGSAHDQQMMTSYYREDISGLPEMGTVARQLWNQS
FT                   GLGPDDIQTAVIYDHFTPFVLTQLEEFGFCGRGEARDFIRDGAIHIGGRLPLNTHGGQL
FT                   GEAYIHGMNGIAEAVRQARGTAVNQVPDVHNVLVTAGTGVPTSGLVLSAV"
     atgtccctgg cgggcgaagc agcgatcgtc ggtatcggtg ccacggagtt ctccaaggag        60
     tccggacgca gtgaactcca gctctgcctg gaggcttgca aggccgcact ggacgacgcc       120
     gggatcgcgc cgcgcgacgt cgacggtctg gtgacgttct ccatggactc cagcccttcg       180
     atcatggtgg gtcgcggact gggcgtcgcc gagctgcggc acttctccct cgtcgactat       240
     ggaggcggcg ccgcctgtgc gaccgtcgcg cacgcagctg ccgcgatcac agctggcctc       300
     gccgacgtcg tggtctgcta ccgcgccttc aacgagcgct ccggtcggcg gttcggctcc       360
     ggggacgccg cgatccaggc tcgtggcgaa tccccgatgg cacagcactt cggctactac       420
     tcgccctatg ggctcatcac tcctgcagcc tgggtcgcga tggccgcacg ccgctatatg       480
     cacaagtacg gagccacatc ggaggacttc gggcgtgtcg cggtggcggc gcggactcac       540
     gccgccacaa accccgcagc gtggttctac gagcgcccca tcaccttggc tgaccaccag       600
     agctcgaagc ttatcgccga cccggtgcgg ctgctggact gctgccagga gtcagacggc       660
     ggagtcgccc tggtagtcgt ttccgcggag cgcgcgcgtg acctccctgg gaaggaagtc       720
     cttatagcgg gcgccgcaca gggttcggcg catgaccaac agatgatgac cagctactac       780
     cgcgaggaca tatccggact ccccgagatg ggcactgtcg cgcggcaact gtggaaccaa       840
     tccgggctgg gaccggacga catccagacc gccgtcatct acgaccactt cactccgttc       900
     gtcctgacgc agctggagga attcggcttc tgcgggcgcg gcgaggcgcg cgacttcatc       960
     cgcgacggcg ccatccacat cggcggacgg cttccgctca acactcacgg cggccagctc      1020
     ggcgaggcct acatccacgg catgaacggc atcgccgagg cggtccgcca ggcccgggga      1080
     acggccgtga accaggtccc ggacgtccat aacgtgctgg tcacagcagg taccggcgtc      1140
     ccgacgtccg ggctcgtgct cagtgcggtc tga                                   1173
//

If you have problems or comments...

PBIL Back to PBIL home page