(data stored in ACNUC7421 zone)

EMBL: CP001700.PE64

CP001700.PE64        Location/Qualifiers
FT   CDS_pept        64495..65247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0064"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 1; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: sma:SAV_7535 hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69019"
FT                   /db_xref="GOA:C7QH80"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH80"
FT                   /inference="protein motif:TFAM:TIGR01549"
FT                   /protein_id="ACU69019.1"
FT                   /translation="MSGDADPTGLSSTAATARNPVFRWASERSVNLGAMPRLALFDLDD
FT                   TLISSKGAFIAWTEELVAAHSSPADVRWFIDNEHIFWTGSPDDAFRGLVEHFGLAADPA
FT                   ELLADYQFRMVDLLKPFDGVLDGLEALRDAGWRIGIVTNGFGDFQNAKIDAVGLRAYVD
FT                   VVCISDVEGSWKPESKIFQLASERAGAPLEGGWMVGDSLSSDIAGGNGVGLHTAWIRHG
FT                   RTLGSMDPQPEQVVETTTEAFQLILSRP"
     gtgtccggcg acgccgatcc gaccggtctg agcagcaccg ccgccaccgc ccgtaacccg        60
     gtgttccgtt gggcgtcgga acgatcagtt aatctcggag ccatgccccg tctcgcgctc       120
     ttcgacctgg acgacaccct gatctcctcc aagggcgcct tcatcgcctg gaccgaggag       180
     ctggtcgcgg cccacagctc cccggctgac gtgcgctggt tcatcgacaa cgagcacatc       240
     ttctggaccg gatcgccgga cgacgccttc cgcggcctgg tcgagcactt cggcctggcc       300
     gcggacccgg ccgagctgct ggccgactac caattccgca tggtcgacct gctcaagccc       360
     ttcgacggcg tgctggacgg cctggaggcg ctgcgcgacg ccggctggcg gatcggcatc       420
     gtcaccaacg ggttcggcga cttccagaac gccaagatcg acgcggtcgg gctgcgcgcc       480
     tacgtggacg tcgtctgcat ctccgacgtc gagggcagtt ggaagcccga gtcgaagatc       540
     ttccaactgg cctccgaacg tgccggggca cctctggaag gcggctggat ggtcggcgac       600
     tccctgagct cggacatcgc cggcggcaac ggcgtgggcc tgcacaccgc ctggatccgg       660
     cacggccgca cgctgggcag catggacccg cagccggagc aggtcgtcga gaccacgacc       720
     gaggcttttc agctgatcct cagccggccc tga                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page