(data stored in ACNUC7421 zone)

EMBL: CP001700.PE65

CP001700.PE65        Location/Qualifiers
FT   CDS_pept        65385..66143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0065"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: TipAS antibiotic-recognition domain protein;
FT                   regulatory protein MerR; SMART: regulatory protein MerR;
FT                   KEGG: sgr:SGR_941 MerR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69020"
FT                   /db_xref="GOA:C7QH81"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012925"
FT                   /db_xref="InterPro:IPR036244"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH81"
FT                   /inference="protein motif:PFAM:PF07739"
FT                   /protein_id="ACU69020.1"
FT                   /translation="MSWSIAQVARMSGVTARTLRHYDDIGLLKPDHVGANGYRYYEEAQ
FT                   LLRLQQILVLRELGLGLSEIAEAIDSEPDTIVALRRQYGRLLVERDRLSRVAETVRRTI
FT                   AELEGKPQMSVHINRPENLFEGFEESQYEDEARERWPEEFEQAQAKRATMTEEDLERWQ
FT                   REATAAMIRMAEFMAAGTPVDDPAVQDEVHQHYQGICIWWTPNRSAYKCVGQMYVDDER
FT                   FKANYLKIAEGLAEYQAAAMAAYADARLTD"
     atgagctggt cgatcgcgca ggtggcgcgg atgtccgggg tcaccgcccg aactctgcgc        60
     cactacgacg acatcgggct tctcaagccc gaccacgtcg gcgccaacgg ctaccgctac       120
     tacgaggagg cgcagctgct gcgcctgcag cagatcctcg tcctgcgcga gctgggactc       180
     ggcctgtccg agatcgccga ggcgatcgat tccgaaccgg acacgatcgt ggccctgcgc       240
     cggcagtacg gccggctgct cgtcgagcgc gaccggctct cgcgggtcgc cgagaccgtg       300
     cggcggacca tcgccgagct ggaagggaag ccacagatgt ccgtgcacat caaccggccg       360
     gagaacctct tcgaggggtt cgaggagtcg cagtacgagg acgaggcgcg cgagcgctgg       420
     cccgaggagt tcgagcaggc ccaggccaag cgcgccacca tgaccgagga ggacctcgag       480
     cgctggcagc gcgaggcgac cgccgcgatg atccggatgg cggagttcat ggccgccggg       540
     acaccggtcg acgacccggc ggtgcaggac gaggtccacc agcactacca gggcatctgc       600
     atctggtgga cgccgaaccg cagcgcgtac aagtgcgtcg gccagatgta cgtcgacgac       660
     gaacgcttca aggcgaacta tctgaagatc gccgaagggc tcgcggagta ccaggcggct       720
     gcgatggccg cctatgcgga cgcgcgcctg accgactag                              759
//

If you have problems or comments...

PBIL Back to PBIL home page