(data stored in ACNUC7421 zone)

EMBL: CP001700.PE66

CP001700.PE66        Location/Qualifiers
FT   CDS_pept        complement(66209..67510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0066"
FT                   /product="Na+/H+ antiporter NhaA"
FT                   /note="TIGRFAM: Na+/H+ antiporter NhaA; PFAM: Na+/H+
FT                   antiporter NhaA; sodium/hydrogen exchanger; KEGG:
FT                   sgr:SGR_3327 putative sodium/proton antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69021"
FT                   /db_xref="GOA:C7QH82"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH82"
FT                   /inference="protein motif:TFAM:TIGR00773"
FT                   /protein_id="ACU69021.1"
FT                   /translation="MTPPDRPASPSRVFARLKRIERRHVAAVLRTETVGGALLIAFALL
FT                   GLLWANSPWRASYDTVKNTVVGPHLWHLDLSLADWAADFLLAFFFLVAGIELKHELQAG
FT                   ELSNPRAAALPVVSALCGMIVPIGVYLAVSAGHTNAGEGWAVPTATDIAFALAVLAVVG
FT                   QNLPSALRAFLLTLAVVDDLGAIIIIAIAYTDSIDTGALVIAAVLLLAFYVVQRMRITS
FT                   LWLNVPLGLAIWIAVHASGVHATVAGVAIGLMLRGRRHGDSDEDHDDELQSPAEKVQWR
FT                   LQPFSAGFCVPVFAIMSAGVYVGGKTLGSLVSDQIPLAIAAGLFIGKAVGVFGGAYLTA
FT                   RFTRAELSDELQWRDIAAVSALTGVGFTVSLLIAELGFSDSPDVLNLAKGGVLLGSLAS
FT                   ALFAVVLLRRRDRFYDQLCTAEESEDSELVLGRE"
     atgacgcccc cggaccgccc cgcctccccg tcgcgcgtct tcgcgcgcct gaagcgcata        60
     gagcgcaggc atgtggcggc agtgctccgg accgagaccg tcggcggcgc gttgctgatc       120
     gccttcgcgc ttctcgggct gctgtgggcg aactctccgt ggcgcgcctc ctacgacacc       180
     gtcaagaaca ccgtcgtcgg accgcaccta tggcatctgg acctgtcgct ggcggactgg       240
     gctgcggact tcctgctcgc gttcttcttc ctggtcgccg ggatcgagct caagcacgag       300
     ctgcaagccg gcgagctgtc gaacccgcgt gccgcggcat tgccggtcgt ctcggcgctg       360
     tgcggcatga tcgtgccgat cggggtctac ctcgcggtca gcgccggaca cacgaacgcc       420
     ggcgagggct gggccgtgcc caccgccacg gacatcgcgt tcgcgctggc ggtgctggcc       480
     gtcgtcgggc agaacctgcc gtcggcgctc cgtgccttcc tgctgaccct cgcggtcgtg       540
     gacgacctcg gtgcgatcat catcatcgcg atcgcgtaca cggacagcat cgacaccggg       600
     gcgctggtca tcgcggcggt cctgctcctc gccttctatg tggtgcagcg gatgcgcatc       660
     accagcttgt ggctcaacgt gccgctgggg ctggccatct ggatcgcggt gcacgccagc       720
     ggcgtccacg cgacggtggc cggcgtggca atcggtttga tgctgcgcgg ccgacgtcac       780
     ggagacagcg atgaggacca cgacgacgaa ctccagtcgc ctgccgagaa ggtgcagtgg       840
     cggttgcagc cgttctccgc gggcttttgc gtcccggtct tcgcgatcat gtccgcgggg       900
     gtctacgtcg gcggcaagac gctgggcagc ctggtcagcg accagattcc gctggccatc       960
     gccgcgggct tgttcatcgg caaggcggtc ggggtgttcg gcggtgctta tctgactgcg      1020
     cgcttcaccc gtgccgagtt gtccgacgaa ctgcagtggc gcgacatcgc ggcggtgtcc      1080
     gcgctcaccg gcgtcgggtt caccgtctcg ctcctgatcg ccgaactcgg cttctccgac      1140
     agtccggatg tcctgaatct cgctaagggc ggagtactac tgggttcact ggcatccgcc      1200
     ctcttcgctg tagtactcct gcgccggagg gatcgcttct acgaccaact gtgcactgcc      1260
     gaggagtcgg aagactcaga actggtgctc gggcgagaat ag                         1302
//

If you have problems or comments...

PBIL Back to PBIL home page