(data stored in ACNUC7421 zone)

EMBL: CP001700.PE67

CP001700.PE67        Location/Qualifiers
FT   CDS_pept        complement(67729..69684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0067"
FT                   /product="acetate/CoA ligase"
FT                   /note="TIGRFAM: acetate/CoA ligase; PFAM: AMP-dependent
FT                   synthetase and ligase; KEGG: sgr:SGR_3326 putative
FT                   acetyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69022"
FT                   /db_xref="GOA:C7QH83"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH83"
FT                   /inference="protein motif:TFAM:TIGR02188"
FT                   /protein_id="ACU69022.1"
FT                   /translation="MSNEALSNLLREDRRFAPSAAFAADANVKADAYAAAEADRLAFWD
FT                   TQASRLSWDTPWSETLDWSGMPVAKWFVGGKLNVAYNCVDRHVEAGNGDRVAIHFEGEP
FT                   GDSRAITYAELKDEVSKAANALTELGVRQGDRVAIYMPMIPETAVAMLACARIGAVHSV
FT                   VFAAFSPDALRARIEDAGAKLLITADGYHRRGGTVNLKANADEAVNGAETIENVLVVKR
FT                   TGADVAWGDKDVWWHDAVGGASTEHTPEAFDSENPLFILYTSGTTGKPKGILHTTGGYL
FT                   TQASYTHHAVFDLKPESDVYWCTADVGWVTGHSYIVYGPLSNGVTEVMYEGTPDTPHQG
FT                   RFWEIIQKYKVSLLYTAPTAIRMFAKWGDDIPAKFDLSSLRLLGSVGEPINPEAWIWYR
FT                   KNIGGDRTPVVDTWWQTETGAIMISPLPGVTEAKPGSAMRPLPGISANVVDKDGNIVGN
FT                   GHGGLLVLDKPWPSMARGIWGDQQRFIDTYWARFAEQGYYFAGDGAKKDEDGDLWLLGR
FT                   VDDIMLVSGHNISTTEVESALVSYPAVAEAAVVGAKDETTGQRIVAFVILRAGQEETEG
FT                   LDAALKAHVSKEIGPIAKPKQIQIVPELPKTRSGKIMRRLLKDVAEDRVVGDTTTLADS
FT                   TVMDLIKAKLPHANED"
     gtgtcgaacg aggccctttc caacctgctc cgtgaggacc gccggttcgc gccgtccgcg        60
     gccttcgccg ccgacgcgaa cgtcaaggcc gacgcgtacg ccgcggctga ggcagaccgg       120
     ctggcgttct gggacacaca ggcctcgcgc ctgtcctggg acacgccctg gagcgaaaca       180
     ctggactggt cgggtatgcc ggtcgccaag tggttcgtcg gcgggaagct gaacgtcgcc       240
     tacaactgcg tggaccgcca tgtggaggcc ggcaacggcg accgcgtggc catccacttc       300
     gagggcgagc ccggcgactc ccgcgccatc acctatgccg aactcaagga cgaggtctcc       360
     aaggccgcca acgcgctgac cgagctcggt gtgcgccagg gcgaccgcgt cgcgatctac       420
     atgccgatga tcccggaaac cgctgtagcg atgctcgcct gtgcgcgcat cggtgcggtg       480
     cactccgtgg tgttcgcagc gttctccccc gacgcgctgc gcgcgcgcat cgaggacgcc       540
     ggcgccaagc tgctgatcac cgccgacggc taccaccgcc gcggcggcac ggtgaacctg       600
     aaggcgaacg ccgacgaggc cgtgaacggc gccgagacca tcgagaacgt gctggtcgtg       660
     aagcgcaccg gcgcggacgt cgcctggggc gataaggacg tctggtggca cgacgcggtg       720
     ggcggggcgt ccaccgagca cacccctgag gccttcgaca gcgagaaccc gctgttcatc       780
     ctctacacgt ccgggaccac gggtaagccc aagggcatcc tgcacacgac cggcggctac       840
     ctgacgcagg cttcgtacac gcaccacgcg gtgttcgact tgaagccgga atccgatgtg       900
     tactggtgca ccgccgacgt cggttgggtc accgggcact cctacatcgt ctacgggccg       960
     ctctccaacg gcgtgaccga ggtcatgtac gagggcaccc ccgacacccc gcatcagggc      1020
     cgcttctggg agatcatcca gaagtacaag gtcagcctcc tgtacaccgc ccccaccgcg      1080
     atccgcatgt tcgccaagtg gggcgacgac atcccggcga agttcgacct ctcctcgctg      1140
     cgcctgctgg gctcggtcgg cgagccgatc aaccccgagg catggatctg gtaccggaag      1200
     aacatcggcg gcgaccgcac tccggtggtc gacacctggt ggcagaccga gaccggggcg      1260
     atcatgatct ccccgctgcc gggtgtcacc gaggccaagc cgggctcggc gatgcggccg      1320
     ttgccgggca tctcagccaa cgtcgtggac aaggacggca acatcgtcgg caacggccac      1380
     ggcgggctgc tggtcctgga caagccctgg ccctccatgg cccgcggcat ctggggcgac      1440
     cagcagcgct tcatcgacac ctactgggcc cgcttcgccg agcagggcta ctacttcgcc      1500
     ggcgacggcg ccaaaaagga cgaggacggc gacctgtggc tgctgggccg cgtcgacgac      1560
     atcatgctcg tctccggcca caacatctcc accaccgaag tcgaatccgc cctcgtgtcc      1620
     tacccggctg tggctgaggc cgcggtggtc ggcgccaagg acgagaccac cggacagcgc      1680
     atcgtcgcct tcgtcatcct gcgcgccggc caggaggaga ccgagggctt ggacgcggca      1740
     ctgaaggcgc acgtctccaa ggagatcggc ccgatcgcca agcccaagca gatccagatc      1800
     gtgcccgaac tgcccaagac gcgctccggc aagatcatgc ggcgcctgct caaggacgtc      1860
     gccgaggacc gcgtcgtcgg cgacaccacc accctggccg actccacggt catggatctg      1920
     atcaaggcga agctgccgca cgccaacgag gactga                                1956
//

If you have problems or comments...

PBIL Back to PBIL home page