(data stored in ACNUC7421 zone)

EMBL: CP001700.PE68

CP001700.PE68        Location/Qualifiers
FT   CDS_pept        complement(70063..70797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0068"
FT                   /product="two component transcriptional regulator, LytTR
FT                   family"
FT                   /note="PFAM: response regulator receiver; LytTr DNA-
FT                   binding region; SMART: response regulator receiver; KEGG:
FT                   stp:Strop_4494 LytTr DNA-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69023"
FT                   /db_xref="GOA:C7QH84"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH84"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACU69023.1"
FT                   /translation="MTIATPTGLRVLVVDDEPPAVAELAYLLSRDPRVSSVRTATDGED
FT                   ALRVLKNSPVDALFLDIRMPGLDGLEIAALLNQFATPPQIVFVTAHEEFALEAFDLHAS
FT                   DYILKPVRAERLAEALRRMTPASAPPRAPEAGPYDVIPVELAGVTRFIPRQEVSYAEAQ
FT                   GDYVRLYTASSSHLVRIPLAVLEEHWSGAGFARTHRRFLVRVDAVSEARWESGHLTVIV
FT                   GGVPIPVARRHTREVRERLSHR"
     atgacgatcg caacgccgac cggcctgcgc gtgctggtcg tcgatgacga acccccagcc        60
     gtcgccgaac tcgcctacct cctgtcccgc gaccctcgcg tctcctccgt acggaccgct       120
     accgacggag aggacgcact gcgggtcctg aagaactctc ctgtagacgc actgttcctc       180
     gacatccgta tgcccggcct ggacggtctg gagatagcgg cgctcctgaa ccagttcgcc       240
     actccgccac agatcgtctt cgtgaccgca catgaggagt tcgctctgga ggcgttcgac       300
     ctccacgcct ccgactacat cctcaaaccg gtacgcgccg aacgcctcgc ggaagctctc       360
     cgccggatga caccggcatc cgcaccacct agggcccccg aagcggggcc ctacgacgtc       420
     atccctgtgg agctggccgg cgtcacacgc ttcatcccgc gccaagaggt ctcctatgcg       480
     gaagcgcaag gcgattacgt gcgcttgtac acagccagca gcagccacct ggtccgcatc       540
     cccttggcgg tcctggagga gcactggtcc ggcgccggct tcgcgcggac gcatcgccgt       600
     ttcctggttc gtgtcgacgc cgtctccgag gcgcggtggg agagcggcca cctgaccgtc       660
     atcgtcggcg gagtccccat ccccgtggcg cgtcggcaca cccgtgaagt gcgcgaacgg       720
     ctcagtcacc gctga                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page