(data stored in ACNUC7421 zone)

EMBL: CP001700.PE69

CP001700.PE69        Location/Qualifiers
FT   CDS_pept        complement(70820..72022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0069"
FT                   /product="signal transduction histidine kinase, LytS"
FT                   /note="PFAM: histidine kinase internal region; ATP-binding
FT                   region ATPase domain protein; SMART: ATP-binding region
FT                   ATPase domain protein; KEGG: nca:Noca_0358 histidine kinase
FT                   internal region"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69024"
FT                   /db_xref="GOA:C7QH85"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH85"
FT                   /inference="protein motif:PFAM:PF06580"
FT                   /protein_id="ACU69024.1"
FT                   /translation="MASNPATVGIVAALVAPAVAVSRAVQRHRLAGTSAERAAYAAMHA
FT                   VALAGPPLRGGLTPDATRRAARHLRPLLGTAALAFNDTERTLTWDGAGQHRHSQDSYEL
FT                   STTALKSGSVSVLGPEEVHCGSDSCMIRHAVVAPIIPPSSIGGIRADGGSTAIGTLSVY
FT                   SSSTSVALVRAVGEVAYWVATQIELAELDRSRTLLMETELRALRAQISPHFIYNSLTAI
FT                   ASFTRTDPQRARELLLEFADFTRYSFRAHGEFTTLAEELRCVDRYLLLERARFGERLQV
FT                   ALRIAPEVLPVEVPFLCVQPIVENAVRHGLEGKPGPGHVTITAEPTRHDYRITVADDGV
FT                   GITPDILRDALAPAEPGTRTSVGLSNVHERLRAVYGTAYGLAIESEPGAGTTVVIRVPK
FT                   K"
     gtggcatcca accccgccac cgtcggcatc gtggccgctt tggtcgcccc ggcggtcgcg        60
     gtgtcccgcg cggtccagcg gcaccgcctc gccggtacgt cggccgagcg cgccgcctat       120
     gccgcgatgc acgccgtcgc cctcgccggg cctccgctgc gcggcggcct gacgccggac       180
     gccactcgcc gcgccgcacg ccatctgcgg ccgttgctcg gcactgcggc gctggcgttc       240
     aacgacaccg agcgaaccct cacctgggac ggcgccggac agcatcggca ttctcaggac       300
     tcctatgagc tctccaccac tgcgctcaag tccggaagcg tgtccgtact cggtccggaa       360
     gaagtgcact gcggcagcga ctcctgcatg atccgtcacg cggtcgtggc tccgatcatc       420
     ccgcccagca gcatcggagg aatccgcgcg gacggtggca gtacggccat cgggacgctg       480
     tccgtgtaca gctccagcac ctccgtggcc ctcgtacggg ccgtcggcga agtcgcgtac       540
     tgggtcgcca cgcagataga actcgcggaa ctcgaccgct cacggaccct cctcatggag       600
     accgagctca gagcactgcg cgcgcagatc tctccgcact tcatctacaa ctcgctcacc       660
     gccatcgcct cctttacgcg cacagacccg cagcgcgcca gggaactcct cctggagttt       720
     gcggacttca cccgctactc gttccgcgca cacggcgaat tcacgacgct cgccgaggag       780
     ctgcgctgtg tggaccgcta cctgttgctg gaacgagcgc gcttcggcga acgcctccag       840
     gtggcactgc gcatcgctcc tgaggtgctc ccggtagagg ttcccttcct atgcgttcag       900
     cccatagtgg agaacgcagt acggcacggc ttggaaggca agcccggtcc cggacacgtc       960
     accatcaccg ccgaaccgac gcgccacgac taccgcatca ccgtcgcgga cgacggcgtc      1020
     gggatcaccc cggacatcct gcgcgacgcc ctcgcacccg cggagcccgg cacgcggacc      1080
     tcggtcggac tgtccaacgt ccacgaaagg ctccgcgcgg tctacggaac cgcatacggc      1140
     ttggcgatcg aatcagaacc cggagcgggt accacagtgg tgatccgggt ccccaagaag      1200
     tag                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page