(data stored in ACNUC7421 zone)

EMBL: CP001700.PE7

CP001700.PE7         Location/Qualifiers
FT   CDS_pept        9293..11920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0007"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.6.2.3"
FT                   /note="KEGG: sma:SAV_4322 DNA gyrase subunit A; TIGRFAM:
FT                   DNA gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV
FT                   subunit A; DNA gyrase repeat beta-propeller; SMART: DNA
FT                   gyrase/topoisomerase IV subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68962"
FT                   /db_xref="GOA:C7QFM3"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFM3"
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /protein_id="ACU68962.1"
FT                   /translation="MDETPQGDRIDPVDLQTEMQRSYLDYAMSVIVGRALPDVRDGLKP
FT                   VHRRVLYAMYDGGYRPEKGYYKCARVVGEVMGIYHPHGDSPIYDTLVRLAQPWSLRMVL
FT                   VDGNGNFGSPGNDPAAAMRYTECKMAPLAMEMVRDIDEDTVDFRPNYDGRSSEPVVLPA
FT                   RFPNLLVNGSTGIAVGMATNIPSHNLREVNDGVQWFLQNPEATNEELLEALIERIKGPD
FT                   FPTGALIVGRRGIEDAYRTGRGSITMRAVVNTEEINGRMCLVVTELPYQVNPDNLALKI
FT                   AELVKDGKVAGIADVRDESSSRTGQRLVIVLKRDAVAKVVLNNLYKHTQLQDSFGANML
FT                   ALVDDVPRTLSLDAFIRHWVTHQIDVIVRRTRFRLRKAQERAHILVGLLKALDAIDEVV
FT                   ALIRRSPTVDEARSGLIELLTIDEIQANAILEMQLRRLAALERQRIEAEHNELMAKIAD
FT                   YTAILESPERQRRIVSEELQAISDKYGDDRRSQLVPYEGDMSIEDLIPEEDVVVTITRG
FT                   GYTRRTRTDLYRSQKRGGKGVKGAQLKQDDIVDHFFVTTTHHWLLFFTNKGRVYRAKAH
FT                   ELPDTARDARGQHVANLLAFLPDEKIAQVLDLRDYEQTPYLVLATKNGLIKKTPLKDYD
FT                   SPRSAGVIAINLREDDELIAAELVSPEDDLLLVSKQAQGLRFTATDEALRPMGRATSGV
FT                   IGMRFREDDELLSMDVVRPDTFLFTATSGGYGKRTAVEMFPLRGRGGLGVIAAKTVDER
FT                   GGLVGAAVVDEGDEVMAITLSGGVIRTRVSEVRPTSRDTMGVRVINLGKGDTVLAIARN
FT                   GDPGEVEDELGEEAGAPAEAAGADVVAEARENGAVVEASEGSEVIDESEGSDESDGSEA
FT                   SSEE"
     gtggacgaga cgccgcaggg ggaccggatc gacccggtcg acctccagac ggagatgcag        60
     cgctcgtacc tggattacgc gatgagcgtg atcgtcggcc gcgcgctgcc cgacgtccgg       120
     gacggcctga agccggtgca ccgccgcgtc ctgtacgcga tgtacgacgg cggctaccgg       180
     ccggagaagg gctactacaa gtgcgcccgc gtcgtcggcg aagtcatggg tatctaccac       240
     ccgcacggcg actccccgat ctacgacacc ctggtccgtc tggcgcagcc ctggtcgctg       300
     cggatggtgc tggtcgacgg caacggcaac ttcggctccc cgggcaacga cccggccgcg       360
     gccatgcggt acaccgagtg caagatggcg ccgctggcca tggagatggt gcgggacatc       420
     gacgaggaca ccgtcgattt ccgccccaac tacgacggcc gctcctccga gccggtggtg       480
     ctgcccgcgc gcttccccaa cctgttggtg aacggctcga ccggcatcgc ggtcggcatg       540
     gcgaccaaca tcccgagcca caacctgcgc gaggtcaacg acggcgtcca gtggttcctg       600
     cagaaccccg aggcgaccaa cgaggaactc ctggaagcgc tcatcgagcg catcaagggc       660
     ccggacttcc cgaccggcgc gctgatcgtc ggccgccgcg gcatcgagga cgcctaccgg       720
     accggccgcg gctcgatcac catgcgcgcg gtggtgaaca ccgaggagat caacgggcgc       780
     atgtgcctgg tggtcaccga gctgccctac caggtgaacc ccgacaacct ggcgctgaag       840
     atcgccgagc tggtgaagga cggcaaggtc gccggcatcg ccgacgtccg cgacgagtcc       900
     tcctcccgga ccggccagcg cctggtgatc gtcctgaagc gggacgcggt cgccaaggtc       960
     gtgctgaaca acctctacaa gcacacgcag ctgcaggact ccttcggcgc gaacatgctg      1020
     gcgctggtcg acgacgtgcc gcgcacgctg tcgctggacg ccttcatccg gcactgggtc      1080
     acgcaccaga tcgacgtgat cgtgcgccgc acccgcttcc gcctgcgcaa ggcccaggag      1140
     cgcgcacaca tcctggtcgg gctgctcaaa gcgctggacg cgatcgacga ggtggtggcg      1200
     ctgatccgcc gctcccccac ggtcgacgag gcgcgcagcg gcctgatcga gctgctcacc      1260
     atcgacgaga tccaggccaa cgcgatcctg gagatgcagc tgcgccggct ggccgccctg      1320
     gagcggcagc ggatcgaggc cgagcacaac gagctgatgg ccaagatcgc ggactacacc      1380
     gcgatcctgg agtcgccgga gcggcagcgg cgtatcgtct cggaggagct gcaggcgatc      1440
     tccgacaagt acggcgacga ccgccgctcg cagctggtgc cctacgaggg cgacatgtcc      1500
     atcgaggacc tgatccccga ggaggacgtg gtcgtcacga tcacccgcgg cggctacacc      1560
     cggcggacca ggacggacct gtaccgctcg cagaagcgcg gcggcaaggg cgtcaagggc      1620
     gcgcagctga agcaggacga catcgtcgac cacttcttcg tcaccacgac gcaccactgg      1680
     ctgctgttct tcacgaacaa gggccgggtg taccgggcca aggcgcacga gctgccggac      1740
     acggcccgcg acgcgcgcgg ccagcatgtc gcgaacctgc tggcgttcct gccggacgag      1800
     aagatcgccc aggtgctcga cctgcgggac tacgagcaga cgccgtatct ggtgctggcg      1860
     accaagaacg gcctgatcaa gaagaccccg ctgaaggact acgactcgcc gcgctcggcc      1920
     ggcgtcatcg cgatcaacct gcgcgaggac gacgagctga tcgccgccga gctggtctcc      1980
     cccgaggacg acctgctgct ggtctccaag caggcgcagg gtctgcgctt caccgcgacc      2040
     gacgaggcgc tgcggccgat gggccgggcc acctcgggcg tgatcggcat gcgcttccgc      2100
     gaggacgacg aactgctgtc gatggacgtg gtccgcccgg acaccttcct gttcacggcg      2160
     acctccggcg gctacggcaa gcggaccgcg gtggagatgt tcccgctgcg cggccgcggc      2220
     ggcctgggcg tgatcgcggc caagaccgtc gacgagcgcg gcggcctggt cggcgccgcg      2280
     gtagtggacg agggcgacga ggtcatggcc atcacgctgt ccggcggcgt gatccggacg      2340
     cgggtgtcgg aggtgcggcc cacctcgcgc gacaccatgg gcgtgcgggt gatcaacctc      2400
     ggcaagggcg acacggtgct cgcgatcgcg cgcaacggcg accccggcga ggtcgaggac      2460
     gagctcggcg aggaggccgg cgcgccggcc gaggcggcgg gcgccgacgt ggtggccgag      2520
     gctcgcgaga acggtgcggt ggtcgaggct tcggaaggct ctgaggttat tgacgagtcg      2580
     gagggctctg acgagtcgga cggctcggag gcctccagcg aggagtga                   2628
//

If you have problems or comments...

PBIL Back to PBIL home page