(data stored in ACNUC7421 zone)

EMBL: CP001700.PE70

CP001700.PE70        Location/Qualifiers
FT   CDS_pept        72113..72721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0070"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: nca:Noca_1231
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69025"
FT                   /db_xref="GOA:C7QH86"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH86"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACU69025.1"
FT                   /translation="MNGRAIFLRVSKGEETRRQVLEAAVEVAASTGLASLTIGSLAERA
FT                   GMSKSGLFAHFKSKETLQVQVLEFASEAFVEDVVRPALSAPRGEKRITTLFESWLAVSR
FT                   DGTAECLFVSAAWEYDDQPGPVRDRLVRMHLDFNDSVAQMFRTGIAEGFFAADADPEQF
FT                   AHDLHGIMLIFFQAHRLLGDARAEERARSAFSRLIESNR"
     atgaacggtc gtgctatttt tctccgtgtg agcaagggtg aggaaacccg caggcaggtc        60
     ctggaagccg cggtcgaggt cgcggcctcc accgggctgg cctcgctcac catcggctcg       120
     ctcgccgagc gcgccgggat gtccaagagc gggctgttcg cgcacttcaa gtccaaggag       180
     acgctccagg tccaggtcct ggaattcgcc agcgaggcgt tcgtcgagga cgtcgtccgg       240
     ccggcgctgt ccgccccgcg cggcgagaag cggatcacga cgctgttcga gagctggctg       300
     gcggtgtcgc gcgacggcac cgccgagtgc ctgttcgtct ccgcggcctg ggagtacgac       360
     gatcagccgg gtccggtgcg cgaccggctg gtccgcatgc acctggactt caacgactcg       420
     gtggcgcaga tgttccggac cgggatcgcc gagggcttct tcgccgcgga cgccgatccg       480
     gagcagttcg ctcacgacct gcacgggatc atgctcatct ttttccaggc gcaccggctg       540
     ctcggcgacg ccagggccga ggaacgggcg cgcagcgcgt tctcccgatt gatcgaatcc       600
     aaccgctag                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page