(data stored in ACNUC7421 zone)

EMBL: CP001700.PE71

CP001700.PE71        Location/Qualifiers
FT   CDS_pept        72736..73662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0071"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nca:Noca_1230 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69026"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH87"
FT                   /inference="similar to AA sequence:KEGG:Noca_1230"
FT                   /protein_id="ACU69026.1"
FT                   /translation="MAVSSSSGKKSTTVRAKKALGIGTVRTAFKVLEVVAPGPGARWAE
FT                   RLWLTVPKKPWRPRTPIAVSAGEPFTVTVRRSTVHGTVWGADGPLVYLMHGWGGVAAQL
FT                   DAFVEPLLAAGYRVVSFDAPGHGRSTESFAGPGLATLPEFSEALSSAVDRFGEAHAVIA
FT                   HSFGAAAAVLSVLDGLPVGRLVVVAPVSDPIGFSYEFAKMLGFRERIRTGFLRVLEKRV
FT                   GVSMDRFDIPQRMRDADLTTLPPLLIVHDLGDREVPVASGDRLAALWPGAELDTWTSLG
FT                   HFRILTDPDVVRKVTAFSSVPRTLPVP"
     atggccgtgt cgtcgtcgtc aggcaaaaaa agcacgaccg ttcgtgctaa aaaggcgctc        60
     gggatcggta ccgtgcggac cgcgttcaag gtgctggaag tcgtcgcgcc gggtccgggt       120
     gcgcgctggg ccgagcggct ctggctcacc gtccccaaga aaccgtggcg gccgaggacg       180
     ccgatcgccg tatccgccgg cgagcccttc accgtgaccg tgcggcgcag cacggtgcac       240
     ggaaccgtct ggggcgcgga tggaccgctt gtctacctca tgcacggatg gggcggtgtc       300
     gccgcgcagc tcgacgcctt cgtggaaccg ctactggcgg ccggataccg agtggtgtcg       360
     ttcgacgcgc ccggccatgg caggtcgacg gagagctttg ccggaccggg actcgccaca       420
     ctgccggagt tctcagaggc gctgtccagc gccgtggacc gtttcggaga agcgcacgcg       480
     gtgatcgcgc actccttcgg tgcggcggca gccgtcctgt ccgtccttga cggactcccc       540
     gtagggaggc tggtagtggt ggcgccagta agtgacccga tcgggttctc ttatgagttc       600
     gcgaagatgc tcggcttcag agaacggata cgtactggct tcctcagggt cctggagaag       660
     cgcgtaggcg tatccatgga caggttcgac atcccgcaac ggatgcgcga cgcggacctg       720
     accacgctgc caccgctgct gatcgtccac gacctcggcg accgcgaagt cccggtggcg       780
     agcggcgacc gcctggccgc gctgtggccc ggagccgaac tcgacacctg gaccagcctc       840
     ggccatttcc ggatcctgac cgacccggac gtggtgcgga aggtgacggc gttcagctct       900
     gtgccgcgaa cgcttccggt cccatga                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page