(data stored in ACNUC7421 zone)

EMBL: CP001700.PE72

CP001700.PE72        Location/Qualifiers
FT   CDS_pept        complement(73628..74605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0072"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sgr:SGR_3324 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69027"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH88"
FT                   /inference="similar to AA sequence:KEGG:SGR_3324"
FT                   /protein_id="ACU69027.1"
FT                   /translation="MRIALVGKGGSGKTTVSALLIRHLAAGGRPVLAVDADINQHLGGA
FT                   LGLSEEQAAALSPMAAHLPAIKDYLRGENPLISGTEAMVKTTPPGRGSRLLRLEEENAV
FT                   HSLCATRLPGDMENVRLMVTGGFEEKDLGVSCYHSKIGAAELYLNHLVDGPDEYLVMDM
FT                   TAGADAFASGLFTRFDLTCLVVEPTRKSVSVYQQYREYAKEYDVTIRVVGNKVTGPDDV
FT                   AYLREHTGADLVACLSASHYVRAQEQGRDKGFDTLEPANRTALARLQLEVDAVPQDWAK
FT                   FTRQAVHFHLKNAHAWGDRATGVDLGAQVDPDFVMGPEAFAAQS"
     atgcgcatcg ccctggtcgg caaaggcggc agcggcaaga ccacggtctc ggccctcctg        60
     atccggcacc tggccgccgg cggccgtccg gtgctcgccg tggacgccga catcaaccag       120
     cacctcggcg gagcgctcgg cctttccgag gagcaagccg ccgcgctgag cccgatggcg       180
     gcgcatctgc cggcgatcaa ggactatctg cgcggcgaga acccgctgat ctccggcacc       240
     gaggccatgg tgaagaccac gccgccggga cgcggctcgc gcctgctgcg gctggaggag       300
     gagaacgccg tccacagcct gtgcgcgacg cggctgcccg gggacatgga gaacgtccgg       360
     ctgatggtga ccggcggctt cgaggagaag gacctcggcg tctcctgcta tcactccaag       420
     atcggcgccg ccgagctcta cctgaaccac ttggtggacg gccccgacga gtacctggtg       480
     atggacatga ccgcgggcgc ggacgccttc gcctccggac tgttcacgcg cttcgacctg       540
     acctgcctcg tggtggagcc gacgcgcaag tcagtgtccg tctaccagca gtaccgcgag       600
     tacgccaagg agtacgacgt cacgatccgc gtggtcggca acaaggtgac cggcccggac       660
     gacgtcgctt acctgcgcga gcacactggc gccgacctcg tggcctgcct cagcgcctcg       720
     cactacgtcc gagcgcagga gcagggccgg gacaagggct tcgacaccct cgagccggcc       780
     aaccgcaccg ctctggcgcg ccttcagctg gaagtggacg ccgtgccgca ggactgggcc       840
     aagttcaccc ggcaggcggt ccacttccat ctgaagaacg cgcacgcctg gggcgaccgc       900
     gcgaccggtg tcgacctcgg cgctcaggtc gacccggact tcgtcatggg accggaagcg       960
     ttcgcggcac agagctga                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page