(data stored in ACNUC7421 zone)

EMBL: CP001700.PE73

CP001700.PE73        Location/Qualifiers
FT   CDS_pept        74795..75577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0073"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV_4603 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69028"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH89"
FT                   /inference="similar to AA sequence:KEGG:SAV_4603"
FT                   /protein_id="ACU69028.1"
FT                   /translation="MDTRSPIQRLAAAPNAAEAADTAREAVDRVRRHKVLRSQSARVTA
FT                   ESQLRGARASAALGSLSEAGTDWPLEEVRRRTDLGDEDGSGLLRGALRISGELGTLAPV
FT                   WKRSPIQALSRMHLLAAAGHLDQDRVGRPSGPEAAVTLTTLANELRDPAAAEVPAVVVA
FT                   AAVHAELLVNEPFGWGDGLLARAASRLILADRGLDPQSLAVVEAGHVDVGVEKYLDAAR
FT                   DYATGTEEGLATWLGLYAEAVELGARESLAVCEAIMRG"
     atggacaccc gctccccgat ccagcgcctg gccgccgctc cgaacgccgc cgaggcggcg        60
     gacaccgccc gcgaggccgt ggaccgcgtg cgccggcaca aggtcctgcg cagccagtcg       120
     gcgcgcgtca ccgccgagtc gcagctgcgc ggcgcccgcg cttcggccgc cctcggctcg       180
     ctgagcgagg ccggtaccga ctggccgctg gaggaggtgc gccgccgcac cgacctcggc       240
     gacgaggacg gttccggact cctgcgcggc gcgctgcgga tctccggcga gctcggcacg       300
     ctcgccccgg tctggaagcg ctccccgatc caggcgctgt cgcggatgca cctgctcgcc       360
     gccgccggtc accttgacca ggaccgggtc ggacggccga gcggcccgga ggccgcggtc       420
     accttgacca ccctcgccaa cgagctgcgc gacccggccg ccgccgaggt gccggccgtg       480
     gtggtcgcgg cggcggtaca cgccgagctg ctggtgaacg agccgttcgg ctggggcgac       540
     ggcctgctgg cccgcgcggc gtcccggctg atcctcgccg accgcggcct ggacccgcag       600
     tcgctggcgg tggtcgaggc cgggcatgtg gacgtcggcg tcgagaagta tctggacgcc       660
     gcgcgcgact acgcgaccgg caccgaggag gggttggcga cctggctcgg gctgtatgcg       720
     gaagcggtcg agctcggcgc gcgcgagtcg ctggcggtgt gcgaagcgat catgcgcggc       780
     tga                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page