(data stored in ACNUC7421 zone)

EMBL: CP001700.PE74

CP001700.PE74        Location/Qualifiers
FT   CDS_pept        complement(75654..76394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0074"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: ank:AnaeK_2958 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69029"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH90"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACU69029.1"
FT                   /translation="MSAQGKFTGKTVYVIGASHGIGEGIAAAFAGGGADVLITGRAKER
FT                   LDAAAERIGHPVRVVQSDATRQEDVDALFAAADTKIDHLVLAVSGGMAGLGPLAELTDE
FT                   ALREGFESKVFAQFRVLKAALPHLAPDASVTFIGAGSSRAAFPGTTALAAANGALDAAV
FT                   RPLAAELAPVRVNAVSPGVIDTAWWHPLGENRDGFMEQQAAATPVGRVGQPQDIAEAVL
FT                   FLAGNGFTTGVVLDVNGGTTLARG"
     atgtccgccc aggggaagtt caccggtaag accgtttacg tcatcggcgc cagccacggc        60
     atcggcgagg ggatcgccgc cgcgttcgcc ggcggaggtg ccgatgtcct gatcaccggc       120
     cgcgccaagg agcgcctcga cgccgccgcc gagcggatcg gccacccggt gcgggtggtc       180
     cagtccgacg cgacccgcca ggaggacgtg gacgcgctgt tcgccgcggc ggacacgaag       240
     atcgaccacc tcgtcctggc ggtcagcggc ggcatggccg ggctgggccc gctggccgag       300
     ctcaccgacg aggcgctgcg cgaaggcttc gagagcaagg tgttcgcgca gttcagggta       360
     ctgaaggcgg cgctgccgca cctcgccccg gacgcctcgg tgaccttcat cggcgccggc       420
     agctcgcgcg ccgcgttccc gggcaccacc gccttggcgg cagccaacgg cgcgctggac       480
     gccgcggtcc gcccgctggc tgcggagctg gcaccggttc gggtgaacgc ggtctccccc       540
     ggcgtgatcg acaccgcctg gtggcacccg ctgggtgaga accgcgacgg gttcatggag       600
     cagcaggctg ccgcgacccc tgtgggacgc gtcgggcagc cgcaggacat cgccgaagcg       660
     gtgctgttcc tggccgggaa cggcttcacg accggcgtgg tactggacgt gaacggcggg       720
     accacgctgg ccaggggctg a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page