(data stored in ACNUC7421 zone)

EMBL: CP001700.PE75

CP001700.PE75        Location/Qualifiers
FT   CDS_pept        76491..77075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0075"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: fal:FRAAL3321
FT                   2,4-DAPG biosynthesis transcriptional repressor PhlF"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69030"
FT                   /db_xref="GOA:C7QH91"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH91"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACU69030.1"
FT                   /translation="MERPHTGRRRNEAAREAIIDAAIGLLQEVGYEGFTIERLARDAGV
FT                   GKQTVYRWWPSKAAVIAEAVGTRAQHTIPLPDTGTLAADLREFFETTFRQSEDPKVISE
FT                   LKSMMVASIENPESARPFHDFLASRRATLRVLLERGSARAEVAADADLDFLTDLAYGLL
FT                   WYRGLVGHRPLDDDAARKLAGALVAAAAESQ"
     atggagcgcc cccacaccgg aagacgccgc aacgaggcgg cccgtgaggc gatcatcgac        60
     gccgcgatcg gtctgctgca ggaggtcggc tacgagggct tcacgatcga gcgcctggcc       120
     cgcgacgcgg gagtcggcaa gcagaccgtc taccgctggt ggccctcgaa ggccgcggtc       180
     atcgccgagg cggtggggac gcgcgcgcag cacaccatcc cgctgcccga caccggtacg       240
     ctggcggccg atttgcggga gttcttcgag accaccttcc ggcagtccga ggacccgaag       300
     gtgatcagtg agctgaaaag catgatggtc gcctcgatcg agaatcccga gtcggcgcgc       360
     cccttccacg acttcctggc cagccgccgc gcgaccctgc gggtcctgct ggaacgcggg       420
     tcggcccgcg ccgaggtcgc cgccgacgcg gatctcgact tcctcacgga tctggcctac       480
     ggcctgctct ggtatcgcgg tctggtcggc catcggccac ttgacgacga cgcggcgcgc       540
     aaactcgccg gcgcacttgt ggcagccgct gcggaatcgc agtaa                       585
//

If you have problems or comments...

PBIL Back to PBIL home page