(data stored in ACNUC7421 zone)

EMBL: CP001700.PE76

CP001700.PE76        Location/Qualifiers
FT   CDS_pept        77516..78517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0076"
FT                   /product="NAD(P)H quinone oxidoreductase, PIG3 family"
FT                   /note="TIGRFAM: NAD(P)H quinone oxidoreductase, PIG3
FT                   family; PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   sco:SCO3823 quinone oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69031"
FT                   /db_xref="GOA:C7QH92"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH92"
FT                   /inference="protein motif:TFAM:TIGR02824"
FT                   /protein_id="ACU69031.1"
FT                   /translation="MRAITIAEPGGPEQLVWTEVPDPVVAAGEVLIQVAATAVNRADIL
FT                   QRRGFYTPPPGASSYPGLECSGRVVEVGAGVSGFVPGDEVVALLTGGGYAELVAVPAGQ
FT                   VAPLPKGLSALAAGGLMETVCTVWSNVFMLAGLQAGQTLLVHGGSSGIGTTAIQLAHQL
FT                   GARVIVTAGTAAKLRACRDLGADVGVNYRDEDFVERVAEVTDGQGVDVILDNMGAVYLD
FT                   RNVQALAVDGRLVIIGLQGGVTGEVNLNTLLRKRAGISATTLRARPSEEKARIVAAARD
FT                   AVWPLIEQGRFRVVVDRVLPVDRAAEAHRVVEDSGHVGKVVLDVATVRGSSS"
     atgcgcgcca tcacgatcgc cgagccgggc ggaccggagc agttggtgtg gaccgaggtg        60
     cccgatccgg tcgtcgcggc cggcgaggtg ctgatccagg tcgccgcgac cgcggtgaac       120
     cgcgcggaca tcttgcagcg cagaggtttc tacacgcccc ctccgggagc ctcgtcctat       180
     ccagggctgg agtgctccgg acgggtcgtc gaggtcggcg ccggagtgag cgggttcgtg       240
     ccgggcgacg aggtcgtggc gctgctgacc ggcggcgggt acgccgagct ggtcgcggtg       300
     cccgccgggc aggtcgcgcc gctgccgaag ggcctgagcg cgctggccgc cggcggtctg       360
     atggagacgg tgtgcaccgt ctggtcgaac gtcttcatgc tcgccgggct ccaagccggg       420
     cagacgctgc tggtccacgg cggctccagc ggcatcggga ccaccgcgat ccagctcgcg       480
     caccagctcg gggcacgggt gatcgtcacc gccggcaccg cggccaagct ccgcgcctgc       540
     cgggacctcg gcgccgacgt cggggtgaac taccgcgacg aggatttcgt ggagagggtt       600
     gccgaggtca ccgacggcca aggcgtggat gtgatcctcg acaacatggg cgccgtctac       660
     ctggaccgca acgtccaggc gctggcggtg gacggccggc tggtgatcat cggtttgcag       720
     ggcggggtca ccggcgaggt gaatctgaac accctgctgc gcaagcgggc cggcatcagt       780
     gcaaccacac tgcgtgcgcg gccgtcagaa gagaaggcgc ggatcgtcgc ggcggcgcgg       840
     gacgccgtgt ggccgctgat cgaacagggc cgcttccggg tggtcgtgga ccgggtgctg       900
     ccggtcgacc gggcggccga ggcccaccgg gtggtcgagg acagcgggca cgtcggcaag       960
     gtcgtgctcg acgtggcgac ggtacgcggc agcagcagct aa                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page