(data stored in ACNUC7421 zone)

EMBL: CP001700.PE77

CP001700.PE77        Location/Qualifiers
FT   CDS_pept        78533..79129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0077"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sgr:SGR_3755 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69032"
FT                   /db_xref="GOA:C7QH93"
FT                   /db_xref="InterPro:IPR019695"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH93"
FT                   /inference="similar to AA sequence:KEGG:SGR_3755"
FT                   /protein_id="ACU69032.1"
FT                   /translation="MTGLNGDIFGAMNMSLNNDPDADHDGDLAGRVIVVPADAAGARGD
FT                   DESGENPMNVAEMVEQPAKVMRIGSMIKQLLEEVRAAPLDEASRARLREIHRSSIAELE
FT                   KGLAPELVAELERLSLPFAEDEVPSESELRIAQAQLVGWLEGLFHGIQTALFAQQMAAR
FT                   AQLEQIRRALPPGSVPPGMADGEQPGRISGAGPYL"
     atgacgggat tgaacggcga catcttcgga gccatgaaca tgagcctgaa caacgacccc        60
     gacgccgatc acgacggcga tctggccggc cgggtcatcg tggtgccggc cgacgccgcc       120
     ggcgcgcgcg gggacgacga gtccggcgag aacccgatga acgtcgccga gatggtcgag       180
     cagcccgcca aggtgatgcg catcggctcg atgatcaagc agctgctgga ggaagtgcgg       240
     gcggcgcctc tggacgaggc ctcccgggcc cgcctgcgcg agatccaccg ctcctcgatc       300
     gccgagctgg agaagggtct ggcgccggaa ctggtcgcgg agctggagcg gctgtcgctc       360
     ccgttcgccg aggacgaggt ccccagcgag tccgagctgc gcatcgccca ggcgcagtta       420
     gtcggctggc tggaagggct gttccacggc atccagaccg ctctgttcgc gcagcagatg       480
     gcggcgcggg cgcagctgga gcagatccgg cgcgctttgc cgcccggctc tgtgccgccc       540
     ggcatggccg acggcgagca gccgggccgg atcagcggcg cgggaccgta cctgtag          597
//

If you have problems or comments...

PBIL Back to PBIL home page