(data stored in ACNUC7421 zone)

EMBL: CP001700.PE78

CP001700.PE78        Location/Qualifiers
FT   CDS_pept        complement(79104..80204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0078"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   sgr:SGR_3762 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69033"
FT                   /db_xref="GOA:C7QH94"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH94"
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /protein_id="ACU69033.1"
FT                   /translation="MPGTSGPLQALFLRFGLPAPTAFRPVDSGLLNRSYQITSADRRYF
FT                   LKHYLPWRGIGSGLPDAYGRRRSAAQTLRWQHEAVIRLQAAGLPAVAPLRDVHGRTVAY
FT                   VRGRPFAVFPWNDGVHRHGRHMHDIDARCLGTTLADVHTGLARVLPQVPQPLFVPTASE
FT                   RRAVAEAEQLLAVVDSGPGRDEMDLLSAHRLRERLALIPEVAHLRPAPDAVATVGYIHG
FT                   DFHAGNVMWSALEPGSRVTAIVDWEKTAVAPCGDEVVSTALVFFTGDYSGQLDLDLVRA
FT                   FIGGYAAARPQFSEQELADSVRRVWWERLTDFWILTWHYHHADHRADSLFPATAALVPW
FT                   WTENYAKVLDAFLEGAAAATGTVPRR"
     atgcccggga catcggggcc actccaggcg ctgtttctgc ggttcggact gccggcaccg        60
     accgctttcc ggcctgtcga cagcggactt ctcaatcggt catatcagat cacttccgcc       120
     gatcgccgct acttcctgaa gcactatctg ccctggcgcg gaatcggctc cggactcccg       180
     gacgcgtacg gtcgcaggcg ctccgcagcg cagacactcc ggtggcaaca cgaagccgtg       240
     atccgattac aggcggcggg tctccccgca gtcgccccgc tcagggatgt gcacggccgt       300
     acggtcgcct atgtgcgggg acgccctttt gcagtattcc cctggaacga cggcgtgcac       360
     cgtcacggca gacatatgca cgatatcgac gcgcgctgct tgggcaccac gctcgccgac       420
     gtccacaccg gactggcgcg cgttctcccc caagtcccgc agccgctgtt cgtccccact       480
     gcctccgagc gccgcgccgt cgccgaggcc gagcagctgc tcgcggtggt cgacagcggt       540
     ccgggccggg acgagatgga cttgctctcc gcacaccgat tacgggagcg cttagcgctc       600
     atccccgaag tcgcgcacct ccggcccgcg ccggacgccg tcgcgactgt cggctacatc       660
     cacggcgact tccacgccgg gaacgtcatg tggtcggccc tggagcccgg aagccgggtg       720
     acagcgatcg tcgactggga gaagacggcc gtcgcgccgt gtggggacga agtagtgagc       780
     accgctttgg tgttcttcac cggggactac tcaggtcagc tcgacctgga tctggtgcgt       840
     gcgttcatcg gtggctacgc cgcggcccgt ccgcaattct ccgagcagga gctcgcagac       900
     tccgtacgcc gcgtctggtg ggaacgcctc accgacttct ggatcctgac gtggcactac       960
     caccacgccg accaccgcgc ggactcgctg ttccccgcca ccgcggcact ggtgccgtgg      1020
     tggacggaga actacgcaaa ggtcttggac gccttcctgg aaggcgccgc ggcggctaca      1080
     ggtacggtcc cgcgccgctg a                                                1101
//

If you have problems or comments...

PBIL Back to PBIL home page