(data stored in ACNUC7421 zone)

EMBL: CP001700.PE79

CP001700.PE79        Location/Qualifiers
FT   CDS_pept        80355..81437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0079"
FT                   /product="putative esterase"
FT                   /note="PFAM: putative esterase; KEGG: ace:Acel_0767
FT                   putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69034"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH95"
FT                   /inference="protein motif:PFAM:PF00756"
FT                   /protein_id="ACU69034.1"
FT                   /translation="MAASARGHRRAPKRSRRSPLRAVALFVISTALVVGSGVAFGYATH
FT                   HLGKHQVTDDASVVAPPTGPLSDATDDPSATTNSAPGGKPSVPASPRPSLPKATGPGKV
FT                   TELKVASSDDDWPSRPVFVYRPAVPANVVLPVVYLLHGVPGEPDRIMDAVKAVLDKAFT
FT                   SGGEQPFIVAAPTGEGTAHNDTEWADAVDGKDMVETYMIKDVIPAVEGKTPRPAGMRAI
FT                   VGFSMGGYGAANLTLRHPDLFDQFASMAGYFRVDDPDGMFGSDSKIEAANTPDDMVQKA
FT                   AGKRVLLLEDQQDPDPLIQGEASEFAKRLDDCNCGVDLSWHLEPGGHTYDFVTDSFPKV
FT                   ITFLNQGFTAPAGTTPSAAG"
     atggcggcga gcgcgagagg ccatcgtcgc gcgcccaaac gcagccggcg ttcgcctttg        60
     cgggctgtcg ccctgttcgt cataagcacc gccctggtcg tgggctccgg cgtggcgttc       120
     ggctatgcca cccaccacct cggcaagcac caggtcaccg acgacgccag cgtggtcgct       180
     ccgccaaccg gtccgctgtc cgacgccacc gacgacccgt cggccaccac caactcggcg       240
     cccggcggga agccgagcgt gccggccagc ccgcgtccgt cgctgcccaa ggccaccggg       300
     ccgggcaagg tcaccgagct gaaggtggcg tcgtcggacg acgactggcc ctcgcgcccg       360
     gtcttcgtct accggcccgc ggtgccggcg aacgtcgtgc tgccggtggt ctacctccta       420
     cacggggtgc ccggtgagcc ggaccgcatc atggacgcgg tcaaggctgt gctggacaag       480
     gcgttcacca gcggcggtga gcagccgttc atcgtggcgg cgccgaccgg cgagggcacc       540
     gcgcacaacg acaccgagtg ggccgacgcc gtggacggca aggacatggt cgaaacctac       600
     atgatcaagg acgtgatccc ggcggtcgag ggcaagacgc cgcggccggc cggcatgcgc       660
     gccatcgtcg ggttctcgat gggcggctac ggcgcggcca acctgaccct gcggcatccg       720
     gacctgttcg accagttcgc ctcgatggcc ggctacttcc gtgtcgacga cccggacggg       780
     atgttcggct ccgacagcaa gatcgaggcc gccaacacgc cggacgacat ggtccagaag       840
     gcggccggca agcgcgtgct gctgctggag gaccagcaag atcccgaccc gctgatccag       900
     ggtgaggcgt ccgagttcgc taagcgtctc gacgactgca actgcggcgt ggacctgtcc       960
     tggcacctcg aacccggcgg gcacacctac gacttcgtga ccgactcttt cccgaaggtg      1020
     atcaccttcc tgaaccaggg cttcaccgcg ccggcgggta cgactccgtc agccgccggg      1080
     tga                                                                    1083
//

If you have problems or comments...

PBIL Back to PBIL home page