(data stored in ACNUC7421 zone)

EMBL: CP001700.PE8

CP001700.PE8         Location/Qualifiers
FT   CDS_pept        12855..13391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0008"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV_4323 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68963"
FT                   /db_xref="GOA:C7QFM4"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFM4"
FT                   /inference="similar to AA sequence:KEGG:SAV_4323"
FT                   /protein_id="ACU68963.1"
FT                   /translation="MGTVAYQQSDSAQGQAGTRQQAGGGWGARPNSPAGAPTGAPRYQQ
FT                   QQAPAAAPRGRKARLRVAKVDPWSVMKTTFVLSIAFAVVSVVAAALLWSALNALGVFDS
FT                   INHTLASVAPANQPNSVTLTSVLSFGKVLSFTALVSVVNIVLFTALATLAAYLYNMCSS
FT                   LVGGIEVTLADDTAS"
     atgggaactg tggcgtatca gcaatcggat tccgctcaag gccaggcggg cacccgccag        60
     caggccggcg gcggctgggg cgcgcgcccg aacagcccgg ccggagcccc cacaggcgca       120
     ccccgctacc agcagcagca ggcacccgcc gccgcccccc gcggccgcaa agcccgcctg       180
     cgcgtagcga aggtcgaccc ctggtcggtg atgaagacga ccttcgtcct gtcgatcgcc       240
     ttcgccgtcg tctccgtagt agccgcggcc ctcctgtggt cagccctcaa cgccctcggc       300
     gtcttcgact cgatcaacca caccctggcc tcagtagccc ccgcgaacca gcccaacagc       360
     gtcaccctga cctcggtcct ctccttcggc aaggtcctca gcttcacagc cctcgtgagc       420
     gtagtgaaca tcgtcctgtt caccgcccta gccaccctcg ccgcctacct ctacaacatg       480
     tgctcctccc tcgtaggcgg catagaggtc accctcgccg acgacaccgc ctcctga          537
//

If you have problems or comments...

PBIL Back to PBIL home page