(data stored in ACNUC7421 zone)

EMBL: CP001700.PE80

CP001700.PE80        Location/Qualifiers
FT   CDS_pept        complement(81501..82199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0080"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sgr:SGR_3019 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69035"
FT                   /db_xref="GOA:C7QH96"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH96"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69035.1"
FT                   /translation="MRNLLGSLLAIIGAAATLVSPWQAWYNNRHGSSYKFYEVFGSGVT
FT                   LSGSGIMDSVFLVFLITAVLAVAGVVLRSRALVGAAGVIAFGFTILWMVRQGQAAGELT
FT                   VTGANNRGLGSGVAYAFGGGLLMIIGSLMMTGRTRRTVVAEPARTKTADQAMYGTAATT
FT                   SAPPAITTTAPADKNPVPPAAAPAATPAQTSASAAPTASERTGTERLSKEERQMLGLDE
FT                   DASAEPKKQN"
     atgcggaacc tgctcggcag cctgctcgcg atcatcggcg cggcggccac cctcgtcagt        60
     ccctggcagg cctggtacaa caaccggcac ggcagcagct acaagttcta cgaggtcttc       120
     ggatccggcg tgacgctttc cgggtccggg atcatggact cggtcttcct ggtcttcctc       180
     atcacggcgg tgctggcggt agccggggtc gtgctgcgct cgcgggccct ggtgggtgcc       240
     gccggcgtga tcgcgttcgg cttcaccatc ctgtggatgg tgcgccaggg acaggccgcc       300
     ggcgagctga ccgtcaccgg cgccaacaac cgcgggctgg gctccggcgt ggcctacgcg       360
     ttcggcggcg gactgttgat gatcatcggc tcgctgatga tgaccggccg cacgaggcgg       420
     accgtggtgg ctgagccggc aaggacgaag acagcggacc aagccatgta cggcacggcc       480
     gcgacgacgt cggcgccgcc ggcgatcacg acgaccgccc cggcggacaa gaacccggtg       540
     ccgccggctg cggctccggc tgcgacgccc gctcagacgt cggcctccgc ggcgcccaca       600
     gcgtccgaac gcaccggcac ggagcggctc agcaaggagg agcgccagat gctcggcctg       660
     gacgaggacg cctccgcgga gcccaagaag cagaactag                              699
//

If you have problems or comments...

PBIL Back to PBIL home page