(data stored in ACNUC7421 zone)

EMBL: CP001700.PE81

CP001700.PE81        Location/Qualifiers
FT   CDS_pept        82507..84381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0081"
FT                   /product="chaperone protein DnaK"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: sgr:SGR_3434 putative heat shock protein
FT                   HSP70; TIGRFAM: chaperone protein DnaK; PFAM: Heat shock
FT                   protein 70"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69036"
FT                   /db_xref="GOA:C7QH97"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH97"
FT                   /inference="protein motif:TFAM:TIGR02350"
FT                   /protein_id="ACU69036.1"
FT                   /translation="MARPVGIDLGTTNSVVCVLEGGEPTVITNAEGSRTTPSVVAFAKN
FT                   GEVLVGEVAKRQAVTNVERTIRSVKRHMGTDWKIGIDEKNFTPQQISAFILQKLKRDAE
FT                   SYLSEKVTDAVITVPAYFSDSERQATKEAGEIAGLNVLRIVNEPTAAALAYGLDKGEGD
FT                   QTILVFDLGGGTFDVSLLEVGKDDDGFSTIEVKATNGDNHLGGDDWDNAVVEWLVTQFK
FT                   NAHGVDLSKDKMAMQRLREAGEKAKIELSSSTETSINLPYITASAEGPLHLDEKLTRSQ
FT                   FQQLTSDLLDRCKTPFHQVIKDAGVALSAIEHVVLVGGSTRMPAVADLVRELTGGKEPN
FT                   KGVNPDEVVAVGAALQAGVLKGEVKDVLLLDVTPLSLGIETKGGIMTKLIEKNTTIPTK
FT                   RSETFTTAEDNQPSVQIQVYQGEREIAAYNKRLGMFELTGLPPAPRGLPQIEVTFDIDA
FT                   NGIVNVSAKDLGTGKVQSMVITGGSALPKDEIDRMMREAEQYADEDHSRREAAEVRNQA
FT                   ESLVYSTEKFLKDNEDKVPADVKSEVDAAIGETREALKSEDSATIRSASEKLATTSQKL
FT                   GAALYQQAQASGEAAGAPGGESAGAPGGGADDDVVDAEIVDEGKGGQA"
     atggcacgtc cggtcggcat cgacctcggg acgacgaact ccgtcgtctg cgtcctggaa        60
     ggtggcgagc ccaccgtcat caccaacgcc gagggctccc ggacgacgcc gtccgtggtc       120
     gccttcgcca agaacggcga ggtgctggtc ggcgaggtcg ccaagcgcca ggccgtcacc       180
     aacgtggagc gcaccatccg gtcggtcaag cgccacatgg gcaccgactg gaagatcggc       240
     atcgacgaga agaacttcac gccgcagcag atctccgcgt tcatcctgca gaagctcaag       300
     cgcgacgccg agtcctacct gtccgagaag gtcaccgacg cggtcatcac cgtcccggcc       360
     tacttctccg actccgagcg ccaggccacc aaggaggccg gcgagatcgc gggcctgaac       420
     gtcctgcgca tcgtcaacga gcccaccgcc gcggccctgg cctacggcct ggacaagggc       480
     gagggcgacc agaccatcct ggtcttcgac ctcggcggcg gcaccttcga cgtctcgctg       540
     ctggaagtcg gcaaggacga cgacggcttc tccaccatcg aggtgaaggc caccaacggc       600
     gacaaccacc tcggcggcga cgactgggac aacgcggtcg tggagtggct ggtcacccag       660
     ttcaagaacg cgcacggcgt ggacctgtcc aaggacaaga tggccatgca gcgtctgcgc       720
     gaggccggcg agaaggcgaa gatcgagctg tccagctcga ccgagacctc gatcaacctg       780
     ccctacatca ccgcctccgc cgagggcccg ctgcacctgg acgagaagct cacgcgctcg       840
     cagttccagc agctgacctc ggacctgctg gaccgctgca agacgccgtt ccaccaggtc       900
     atcaaggacg ccggggtggc cctgagcgcg atcgagcacg tggtgctggt cggcggctcg       960
     acccgcatgc cggccgtggc cgacctggtc cgggagctga ccggcggcaa ggagcccaac      1020
     aagggcgtca accccgacga ggtcgtggcc gtcggcgccg cgctgcaggc cggtgtcctc      1080
     aagggcgagg tgaaggacgt cctgctgctg gacgtcaccc cgctgtccct gggcatcgag      1140
     accaagggcg gcatcatgac caagctgatc gagaagaaca ccacgatccc gaccaagcgc      1200
     tcggagacct tcaccaccgc cgaggacaac cagccctcgg tgcagatcca ggtctaccag      1260
     ggcgagcgcg agatcgcggc gtacaacaag cggctgggca tgttcgagct gaccggcctg      1320
     ccgccggcgc cgcgcgggct gccgcagatc gaggtcacct tcgacatcga cgccaacggc      1380
     atcgtgaacg tctcggcgaa ggacctgggc accggcaagg tgcagtcgat ggtcatcacc      1440
     ggcggctcgg cgctgccgaa ggacgagatc gaccgcatga tgcgcgaggc cgagcagtac      1500
     gccgacgagg accacagccg ccgcgaggcc gccgaggtcc gcaaccaggc cgagtcgctg      1560
     gtctactcga ccgagaagtt cctcaaggac aacgaggaca aggttccggc cgacgtgaag      1620
     tccgaggtcg acgccgccat cggcgagacc agggaagccc tcaagagcga ggactccgcg      1680
     accatccgct cggcttcgga gaagctggcg accaccagcc agaagctcgg cgccgcgctc      1740
     taccagcagg cgcaggcctc cggtgaggcg gccggtgctc cgggcgggga gtccgccggc      1800
     gccccgggcg gcggtgccga cgacgacgtg gtggacgccg agatcgtcga cgagggcaag      1860
     ggtggccagg cctga                                                       1875
//

If you have problems or comments...

PBIL Back to PBIL home page