(data stored in ACNUC7421 zone)

EMBL: CP001700.PE82

CP001700.PE82        Location/Qualifiers
FT   CDS_pept        84577..85245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0082"
FT                   /product="GrpE protein"
FT                   /note="PFAM: GrpE protein; KEGG: sma:SAV_4485 heat shock
FT                   protein GrpE"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69037"
FT                   /db_xref="GOA:C7QH98"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH98"
FT                   /inference="protein motif:PFAM:PF01025"
FT                   /protein_id="ACU69037.1"
FT                   /translation="MSDEYAAEREGEGERANLAVTELLAKLAERTNELQGVQAELSERT
FT                   NDLQRLQAEFSNYKKRVERDRQVVKETAVAGALSELLPVLDDIGRAREHGELEGGFRQV
FT                   GEAFEAVVAKLGLARFGAAGELFDPNLHEALLSTTSPDVDEVTVAVLFRPGYRIGERVV
FT                   RAAQVQVAEPGPALETEPAPEPAPKPKPAAPAAKRAPGGAGKTAAEPAAEVDDDDDSGL
FT                   "
     gtgagcgacg agtacgcggc cgagcgggaa ggcgagggcg agcgcgccaa cctcgcggtg        60
     accgagctgc tggccaaact cgccgagcgg accaacgagc tgcagggcgt gcaggccgag       120
     ttgtccgagc gcaccaacga cctgcagcgg ctgcaggccg agttcagcaa ctacaagaag       180
     cgggtcgagc gggaccggca ggtggtcaag gagaccgccg tggccggcgc gctgtccgag       240
     ctgctcccgg tgctggacga catcggccgg gcgcgcgagc acggcgagct ggaaggcggg       300
     ttccgccagg tcggcgaggc cttcgaggcc gtggtggcca aactgggcct ggcccggttc       360
     ggcgcggccg gggagctctt cgacccgaac ctgcacgagg ccctgctgag caccacgtcc       420
     ccggacgtgg acgaggtgac cgtggcggtg ctgttccgcc ccggctaccg gatcggcgag       480
     cgcgtggtcc gcgcggcgca ggtgcaggtc gccgagcccg gaccggcttt ggagaccgag       540
     ccggcacccg agccggcgcc caagcccaag cccgcggcac cggccgcgaa gcgtgcgccg       600
     ggcggagccg gcaagacggc ggccgagccg gccgccgagg tcgacgacga cgacgattcg       660
     ggactgtga                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page