(data stored in ACNUC7421 zone)

EMBL: CP001700.PE83

CP001700.PE83        Location/Qualifiers
FT   CDS_pept        85314..86438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0083"
FT                   /product="chaperone protein DnaJ"
FT                   /note="KEGG: sgr:SGR_3432 putative DnaJ protein; TIGRFAM:
FT                   chaperone protein DnaJ; PFAM: chaperone DnaJ domain
FT                   protein; heat shock protein DnaJ domain protein; DnaJ
FT                   central domain protein; SMART: heat shock protein DnaJ
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69038"
FT                   /db_xref="GOA:C7QH99"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C7QH99"
FT                   /inference="protein motif:TFAM:TIGR02349"
FT                   /protein_id="ACU69038.1"
FT                   /translation="MAVNKDYYKILGVPKDAPAADIKKAYRKLARQYHPDANKGDAASE
FT                   EKFKEISEAYDVLSDDKRRKEYDDSRSVFGNGGFRAPGGGAPGGFNFDLGDLLGGLFNR
FT                   TGGPTTGTSTTGRTTQARRGSDVESEVTLKFSDSIDGATVSLRLTSDTPCSACSGTGAK
FT                   AGTTPRVCPTCSGTGQVSRNQGGFAFSEPCRDCKGRGLLVDDPCPVCHGSGRAASSRTI
FT                   QARIPAGVRDGQRIRLKGKGASGERGGPAGDLYVVVHVSPHPVFGREDDNLTVTVPVTF
FT                   PEAVLGADIQVPTLGGMPVTVKLPANSQNGRVLRVRGRGVARKDGTKGDLLVRFEIAVP
FT                   AEIGDDARAALQKFQEATGNHHPRAELLDSAKGE"
     gtggccgtca acaaggacta ctacaagatc ctcggtgtcc ccaaggacgc gccggctgcc        60
     gacatcaaga aggcctaccg gaagctggcg cgccagtacc accccgatgc gaacaagggc       120
     gacgcggcgt ccgaggagaa gttcaaggag atctccgagg cctacgacgt cctgtccgac       180
     gacaaacggc gcaaggagta cgacgactcg cgctcggtct tcggcaacgg cggcttccgg       240
     gcccccggcg gcggcgcccc cggcgggttc aacttcgacc tcggcgacct gctcggcggg       300
     ctgttcaacc ggaccggcgg cccgacgacc gggaccagca cgaccggccg caccacccag       360
     gcgcggcgcg gctcggacgt ggagtcggag gtgacgctga agttcagcga ctccatcgac       420
     ggcgccacgg tctcgctgcg gctgacctcg gacaccccgt gctcggcgtg ctcgggcacc       480
     ggcgccaagg ccggcaccac cccgcgggtg tgcccgacct gttcgggcac cggccaggtg       540
     agccggaacc agggcggctt cgccttctcc gagccctgcc gggactgcaa gggccgcggc       600
     ctgctggtcg acgacccctg cccggtgtgc cacggctccg gccgggccgc cagctcccgc       660
     acgatccagg cccgcatccc ggcgggcgtc cgcgacggcc agcgcatccg gctcaagggc       720
     aagggtgcct ccggcgagcg cggcggcccg gccggcgacc tgtatgtggt ggtccatgtg       780
     agcccgcacc ccgtcttcgg acgcgaggac gacaacctga ccgtgaccgt gcccgtcacc       840
     ttccccgagg cggtgctcgg cgcggacatc caggtcccga ccctgggcgg catgccggtg       900
     acggtgaagc tgccggccaa ctcgcagaac ggccgggtgc tgcgcgtgcg cggccgcggc       960
     gtggcgcgca aggacgggac caagggcgac ctgctggtgc gtttcgagat cgcggtcccg      1020
     gccgagatcg gcgacgacgc gcgggcggcg ctgcagaagt tccaggaagc gaccggcaac      1080
     caccacccgc gggcggagtt gctggactcc gcgaagggag agtga                      1125
//

If you have problems or comments...

PBIL Back to PBIL home page