(data stored in ACNUC7421 zone)

EMBL: CP001700.PE84

CP001700.PE84        Location/Qualifiers
FT   CDS_pept        86446..86916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0084"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; SMART: regulatory
FT                   protein MerR; KEGG: sma:SAV_4487 HspR protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69039"
FT                   /db_xref="GOA:C7QHA0"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHA0"
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /protein_id="ACU69039.1"
FT                   /translation="MASKNPFLPLTEETPVYVISVAAQLAGMHPQTLRQYDRLGIVCPE
FT                   RTGGGGRRYSARDIDTLREVQRLSQDEGVNLAGIKRIRELEEQVAALSRRVAELEAVTL
FT                   YPTAKGTVPVAAPIAPPVSPLPPAPPGYRGDLLPALPATFTTALAVWKPQGK"
     atggcttcca agaatccgtt cctgccgctc accgaggaaa ctcccgtcta cgtcatctcc        60
     gtggccgcgc agctggccgg gatgcatccg cagaccctgc ggcagtacga ccggctcggc       120
     atcgtgtgcc cggagcgcac cggcggcggt ggccgccggt actccgcgcg ggacatcgac       180
     acgctgcgcg aggtgcagcg gctgtcccag gacgaaggcg tgaacctggc cgggatcaag       240
     cgcatccgcg agctcgagga gcaggtcgcg gcgctgtccc ggcgggtggc cgaactcgag       300
     gccgtgacgc tgtacccgac ggccaagggc acggtcccgg tcgcggcgcc gatcgcgccg       360
     ccggtctcgc cgctgccgcc ggctccgccc ggctaccgcg gcgacctgct gccggccctg       420
     cccgcgacgt tcaccactgc tctggcggtc tggaagcccc agggcaagtg a                471
//

If you have problems or comments...

PBIL Back to PBIL home page