(data stored in ACNUC7421 zone)

EMBL: CP001700.PE85

CP001700.PE85        Location/Qualifiers
FT   CDS_pept        87023..89641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0085"
FT                   /product="ATP-dependent chaperone ClpB"
FT                   /note="KEGG: tfu:Tfu_0200 ATPase; TIGRFAM: ATP-dependent
FT                   chaperone ClpB; PFAM: ATPase AAA-2 domain protein; AAA
FT                   ATPase central domain protein; ATPase associated with
FT                   various cellular activities AAA_5; Clp domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69040"
FT                   /db_xref="GOA:C7QHA1"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHA1"
FT                   /inference="protein motif:TFAM:TIGR03346"
FT                   /protein_id="ACU69040.1"
FT                   /translation="MDSQKLTTKSQEALSVAIREATRAGNPQVESIQVLLALLGQVEGT
FT                   TRPLLEAVGVDRAALSQAVTAAAERLPSASGSTVSAPTLARNTLNALNAAGDEARKLDD
FT                   EYVSTEHLLLGLALGNDSTADLLKKAGATPQALREAFGKVRGSARVTSQDPEATYQALE
FT                   KYGVDLTAAARDGKLDPVIGRDAEIRRVVQVLSRRTKNNPVLIGEPGVGKTAVVEGLAQ
FT                   RIIAGDVPESLRDKRLVSLDLGAMVAGAKYRGEFEERLKAVLADIKDSEGQIVTFIDEL
FT                   HTVVGAGATGDSSMDAGNMLKPMLARGELRMVGATTLDEYRERIEKDPALERRFQQVLV
FT                   DEPTVEDTIAILRGLKGRYEAHHKVAISDTALVAAATLSHRYITSRFLPDKAIDLIDEA
FT                   ASRLRMEIDSRPVEIDELQRTVDRMKMEELALAKEHDPASRDRLARLRLDLADRQEQLN
FT                   ALNARWEQEKSGLNRVGELKQRLDAMKSQVEQAQRSGDFETASRLLYAEIPAVEAELET
FT                   ASTTVDEAEDVAPMVKEEVGPDDIAEVVGAWTGIPAGRLLEGETEKLLTMEQRIGERLI
FT                   GQAEAVAAVSDAVRRARAGISDPDRPTGSFLFLGPTGVGKTELAKALADFLFDDEHAMV
FT                   RIDMSEYSEKHSVARLVGAPPGYVGYEEGGQLTEAVRRRPYSVVLLDEVEKAHPEIFDV
FT                   LLQVLDDGRLTDGQGRTVDFRNTILILTSNLGTSGFDLTVDEALDPVQARLDRRQRVDN
FT                   AVRAAFKPEFLNRLDAQVIFDPLGTTELGRIVDIQVRKLAARLADRRLGLEVTPGARDW
FT                   LAIAGYEPAFGARPLRRLVQSSIGDPLARRLLAGEIRDGDTVRVDVDIENDALIIGSQA
FT                   S"
     gtggattcgc agaagctgac gaccaagagc caggaggccc tgagcgtcgc gatccgcgag        60
     gccacccggg ccggcaaccc ccaggtcgag tcgatccagg tgctgctggc cctgctcggc       120
     caggtcgagg gcaccacccg gccgctgctg gaggcggtcg gcgtggaccg cgccgcgctc       180
     agccaggcgg tcaccgccgc cgccgagcgc ctgccgtcgg ccagcgggtc gacggtctcg       240
     gcgcccaccc tggcccgcaa caccctgaac gccctcaacg ccgccggcga cgaggcgcgc       300
     aagctcgacg acgagtacgt ctcgaccgag catctgctgc tcggtctggc gctgggcaac       360
     gactccacgg ccgacctgct caagaaggcc ggcgccacgc cgcaggcgct gcgcgaggcg       420
     ttcggcaagg tgcgcggctc ggcgcgggtg acgtcgcagg acccggaggc cacctatcag       480
     gccctggaga agtacggcgt cgacctgacc gccgcggcgc gggacggcaa gctcgacccg       540
     gtgatcggcc gcgacgccga gatccgccgg gtggtgcagg tgctctcgcg ccggaccaag       600
     aacaacccgg tgctgatcgg cgagcccggc gtcggcaaga ccgccgtggt cgaaggcctg       660
     gcccagcgca tcatcgccgg cgacgtgccg gagagcctgc gcgacaagcg cctggtgtcc       720
     ctggacctgg gcgcgatggt ggccggggcg aagtaccgcg gcgagttcga ggagcgcctc       780
     aaggccgtcc tggccgacat caaggactcc gagggccaga tcgtcacctt catcgacgag       840
     ctgcacacgg tcgtcggcgc cggcgcgacc ggcgattcgt cgatggacgc cggcaacatg       900
     ctcaagccga tgctggcccg cggcgagctg cggatggtcg gcgcgaccac gctggacgag       960
     taccgcgagc ggatcgagaa ggacccggcg ctggagcggc gcttccagca ggtcctggtc      1020
     gacgagccga cggtcgagga caccatcgcg atcctgcgcg gtctcaaggg ccgctacgag      1080
     gcgcaccaca aggtcgccat ctccgacacc gccctggtcg ccgcggccac gctctcccac      1140
     cgctacatca cctcccgctt ccttccggac aaggccatcg acctgatcga cgaggccgcc      1200
     tcccggctgc gcatggagat cgactcccgc cccgtggaga tcgacgagct ccagcgcacc      1260
     gtggaccgga tgaagatgga ggagctggcg ctggccaagg agcacgaccc ggcctcccgc      1320
     gaccggctgg cccggctgcg cctggacctg gccgaccggc aggagcagct caacgccctg      1380
     aacgcgcgct gggagcagga gaagagcggc ctgaaccggg tcggcgagct caagcagcgg      1440
     ctggacgcga tgaagtcgca ggtcgagcag gcccagcggt ccggcgactt cgagaccgcc      1500
     tcccggctgc tctacgccga gatcccggcg gtggaggccg agctggagac cgcctcgacc      1560
     acggtcgacg aggccgagga cgtcgcgccg atggtcaagg aggaggtcgg cccggacgac      1620
     atcgctgagg tggtcggcgc ctggaccggc ataccggccg gccggctgct cgagggcgag      1680
     accgagaagc tgctgaccat ggagcagcgg atcggcgaac ggctgatcgg gcaggccgag      1740
     gcggtcgccg cggtctccga cgcggtgcgg cgggcgcggg ccggtatctc cgacccggac      1800
     cggccgaccg gctcgttcct gttcctgggt cccaccggtg tcggcaagac cgagctcgcc      1860
     aaggcgctgg cggacttcct gttcgacgac gagcacgcca tggtgcgcat cgacatgtcg      1920
     gagtactccg agaagcactc ggtggcccgg ctggtcggcg cccctcccgg ctacgtcggc      1980
     tatgaggagg gcggccagct gaccgaggcc gtccggcgcc ggccgtactc ggtggtgctg      2040
     ctcgacgagg tcgagaaggc gcacccggag atcttcgacg tgctgctgca ggtgctcgac      2100
     gacggccgcc tcaccgacgg ccagggccgg accgtggact tccgtaacac catcctgatc      2160
     ctcacctcca acctggggac cagcggcttc gacctcaccg tcgacgaggc gctggacccg      2220
     gtgcaggccc ggctggaccg gcgccagcgc gtggacaacg cggtccgggc ggcgttcaag      2280
     ccggagttcc tgaaccggtt ggacgcgcag gtgatcttcg acccgctggg cacgaccgag      2340
     ctcgggcgga tcgtcgacat ccaggtccgc aagctggccg cgcgcctggc cgaccggcgt      2400
     ctgggactcg aggtcacgcc gggcgccagg gactggctgg cgatcgccgg gtacgagccg      2460
     gcattcggcg cgcgtccgct gcgccgcctg gtgcagtcct cgatcggcga cccgctggcc      2520
     cgccggctgc tggccggcga gatccgggac ggcgacacgg tccgcgtgga cgtggacatc      2580
     gagaacgacg cgctgatcat cggttcgcag gcgtcatga                             2619
//

If you have problems or comments...

PBIL Back to PBIL home page