(data stored in ACNUC7421 zone)

EMBL: CP001700.PE86

CP001700.PE86        Location/Qualifiers
FT   CDS_pept        89681..90544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0086"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sgr:SGR_6214 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69041"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHA2"
FT                   /inference="similar to AA sequence:KEGG:SGR_6214"
FT                   /protein_id="ACU69041.1"
FT                   /translation="MPAALPTVIATRYVTALREGGSLPGLVEAADLGTYVVKFRSAGQG
FT                   RKALVAEVIAGELARALALLVPALVGIELDPIIGAAEPDQEIQELLKGSKGLNLGMDYL
FT                   PGSLGYDPLAFPVEPELASRVVWFDALVRNVDRSWRNPNLLLWHRKLYLIDHGASLIFH
FT                   HNWPGAQKGALAPFDANDHVLASYAKDMPGADAALAPLVTEELLRSVVAVVPDEWLVDE
FT                   PGFDSADAVREAYVSYLLTRVVGPREWFPQVVDSSAQEAARAHEGSDLKARLKAKHPNW
FT                   MQGRVK"
     atgcctgccg ctctgccgac cgtcatcgcc acccggtacg tgaccgcgct ccgcgagggc        60
     ggttcgctgc ccggactggt cgaggccgcg gacctcggga cgtacgtggt gaagttccgc       120
     tcggccggcc agggtcgcaa ggctctggtc gccgaggtga tcgccgggga actggcccga       180
     gccctggctc tgctggtgcc agcgctggtc ggcatcgagc tggatccgat catcggtgcc       240
     gccgagccgg accaggagat ccaggaactc cttaagggga gcaagggact gaacctcggt       300
     atggactatc tgccgggttc gctgggatat gaccccttgg cgtttcccgt ggagcccgaa       360
     ctggcgagcc gcgttgtgtg gttcgacgcc ttggtgcgga acgtggaccg gtcgtggcgg       420
     aacccgaacc tcttgctgtg gcatcgcaag ctctatctga tcgaccatgg agcctcgctg       480
     atcttccacc acaactggcc cggcgcacag aagggcgcgc tggctccctt tgacgcgaac       540
     gaccatgtcc tcgcctccta tgcgaaggac atgcccggcg ccgacgccgc gctcgcgccg       600
     ctcgtcaccg aggagttgtt gcggtccgtg gtggcggtcg tgccggacga gtggctggtc       660
     gacgagcccg ggttcgactc tgctgacgcg gttcgcgagg cgtacgtcag ttacctgctg       720
     acccgcgtcg tcggaccgcg cgagtggttt ccacaggttg tggatagttc cgcgcaggag       780
     gccgcacggg ctcatgaggg ctcggatctc aaggcgcgcc tcaaggcgaa gcacccgaac       840
     tggatgcagg gacgggtgaa atga                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page