(data stored in ACNUC7421 zone)

EMBL: CP001700.PE87

CP001700.PE87        Location/Qualifiers
FT   CDS_pept        90541..90918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0087"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO1348 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69042"
FT                   /db_xref="InterPro:IPR021398"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHA3"
FT                   /inference="similar to AA sequence:KEGG:SCO1348"
FT                   /protein_id="ACU69042.1"
FT                   /translation="MSVQPYEYSVLRAVPRVERGEYVNVGVVLYCQQLDFLGCATQLDS
FT                   VRVRALDPTADVEGIEALLGAVSKVCCGGPDSGPAGQDAMGRRFRWLIAPRSTVVQPGP
FT                   VHTGLTADPAAALDRLAGSLL"
     atgagcgttc agccctacga gtactccgtg ctgcgcgcgg ttccccgtgt ggagcgcggc        60
     gagtacgtca acgtcggtgt cgtgctctac tgccagcagc tcgacttcct cggatgcgcc       120
     acgcagttgg attcagtgcg ggtgcgcgca ctcgatccca cagcggacgt tgaggggatc       180
     gaggcgctgc tcggcgcggt ctcgaaggtg tgctgtggcg gaccggactc cggccctgcc       240
     ggtcaggacg ccatgggccg gcggttccgg tggctgatcg cgccgcgctc caccgtggtg       300
     cagcccggtc ctgtgcacac cggtcttacc gctgatcctg cggcagctct cgaccgactg       360
     gctggatcgc ttctttag                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page