(data stored in ACNUC7421 zone)

EMBL: CP001700.PE88

CP001700.PE88        Location/Qualifiers
FT   CDS_pept        complement(90866..91813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0088"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: tfu:Tfu_1700 short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69043"
FT                   /db_xref="GOA:C7QHA4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHA4"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACU69043.1"
FT                   /translation="MGTWGPQGVSGKVVVITGAARGIGADAARRLARRGAKVALIGLEP
FT                   EELRKTAESCGPDATAWDADVTSWEQLGAAIDGIVDHYGGIDVVVANAGVAPTGFIRSI
FT                   DPSAFERTIEINLLGVWRTVRTALPHIIKNKGYVLVVSSAAALIHPPALAAYTASKAGA
FT                   EAFGDSLRAEVKHLGVDVGVAYFSWIKTDLVTSADAHPVLGKFRTSAPGPASRVYPLEK
FT                   VGQAVADGIAKRSRVICVPSWVNQLRRFHGMLPAIVEKANARATARADREMIADIEKRG
FT                   VEASSRLTGPGGAAAQAAKEAIQPVGRELPQDQR"
     atgggaacct ggggaccgca aggcgtcagt ggaaaagtcg tggtcatcac cggtgcggca        60
     cgcggaatcg gcgcggacgc cgcacggcgc ctggcccgcc gcggagcgaa ggtcgcgctg       120
     atcgggctgg agccggagga gctgcgcaag accgcggagt cctgcggacc cgacgccacc       180
     gcgtgggacg ccgacgtgac ctcctgggag cagctcggtg cggcgatcga cggcatcgtc       240
     gaccactacg gcgggatcga cgtcgtcgtg gccaacgccg gcgtcgcccc gaccgggttc       300
     atccgctcca tcgacccgtc ggcgttcgag cgcaccatcg agatcaacct gctcggtgtc       360
     tggcggacgg tacgcaccgc gctgccgcac atcatcaaga acaagggcta tgtactcgtg       420
     gtctcctctg cggcggcctt gatccatccc cctgcgttgg ccgcttatac ggcgtctaag       480
     gccggcgcag aagcgttcgg cgacagtctg cgcgcagaag tgaaacacct aggcgttgat       540
     gtcggtgtcg cctacttctc ctggatcaag acggacttgg tgacgagtgc ggacgcgcat       600
     cccgtcctgg gcaagttccg tacaagcgct cccggtccgg cgtcccgtgt gtatcccttg       660
     gagaaggtcg gccaggcggt cgccgacgga atcgctaagc gcagccgcgt tatctgcgtt       720
     ccctcctggg tcaaccagct acgccgcttc cacgggatgc tgcctgccat cgtggagaag       780
     gccaacgccc gagcgaccgc ccgcgccgac cgcgagatga tcgcggacat cgagaagcgc       840
     ggcgtcgaag cgtcttcgcg gctgaccggt cctggcggag cagccgcgca ggcggctaaa       900
     gaagcgatcc agccagtcgg tcgagagctg ccgcaggatc agcggtaa                    948
//

If you have problems or comments...

PBIL Back to PBIL home page