(data stored in ACNUC7421 zone)

EMBL: CP001700.PE89

CP001700.PE89        Location/Qualifiers
FT   CDS_pept        complement(91864..93579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0089"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; protein of unknown function RIO1;
FT                   aminoglycoside phosphotransferase; SMART: serine/threonine
FT                   protein kinase; tyrosine protein kinase; KEGG:
FT                   fre:Franean1_5221 serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69044"
FT                   /db_xref="GOA:C7QHA5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHA5"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACU69044.1"
FT                   /translation="MTLDMNSDVHKGGSPATDRLGPYLLVTQLGSGAMGRVFLGTDSTG
FT                   RQAAVKVVRSDLADIPAFRKRFSRELNVAERVHSPRVAEIYDAQTEGKRPWLATEYVPG
FT                   PTLQDAVEQGGAFDNEHLRALAVAIAEALEVIHAAEVVHRDLKPANVLLGPDGPKVIDF
FT                   GVARALDASLLTNTGQTLGTPAYMSPEQADGRAVESASDVFALGSLLVFAATGRLAFGD
FT                   GAPLAILHRVVNNDPDLSGVAEDDEVLRGVIEGCLCKEPEDRPSPQQIKDTFGAIGWQP
FT                   LTGVAWQQPPLGVGLPLTAGDAADLPTVAIAPKRGTKRVAVISAATVAALILATIAVVE
FT                   ASGGGKGNTAADTARTGGPTSSSQQNGGAFPSTDTSSGSTSSSGQTTPTSSSPPPPSQA
FT                   SGAPVPPGGGAGSTAPPQGSSQLVTVSVPITQGNGGSSQKPAPTSSHPTTHPSSAHTTS
FT                   AAPPPPPTHNPPGPMVAGDISVLIPNWVGAATVNVSWKAHSDATSYAIHYTVKGTATNS
FT                   DQTVPVSGTSYSYQIPADGTTCLQVRTVNQYGSSAFYPSPMYCVNSFGQVSSGG"
     atgacgttgg atatgaacag cgacgtacac aaggggggtt ctccggcgac cgaccgactg        60
     ggaccgtacc tgctcgtcac tcaactcgga tccggcgcca tggggcgcgt gttcctcggg       120
     acggactcga ccggtcggca ggccgcggtc aaggtggtcc gctccgactt ggcggacatc       180
     ccggcgttcc gtaagcgctt ctcgcgggag ttgaacgtcg cagagcgcgt ccacagcccg       240
     cgcgtcgccg agatctacga cgcgcagacc gagggcaagc ggccgtggct ggcgacggag       300
     tacgtgcccg gcccgacgtt gcaggacgcg gtggagcagg gcggcgcctt cgacaacgag       360
     catctgcggg ctctggcggt cgccatcgcg gaggcgcttg aggtcatcca cgccgccgag       420
     gtcgtccacc gcgacctcaa gccggcgaac gtgttgctcg gtcccgacgg acccaaggtc       480
     atcgacttcg gcgtggcgcg agctctggac gcttcgctgt tgaccaatac aggccaaacg       540
     ctaggaactc cggcgtatat gtcccctgag caagccgacg gacgcgctgt agagagcgcc       600
     tccgacgtgt tcgcattggg ctcgctacta gtcttcgccg cgaccggacg cctagcattc       660
     ggcgacggcg cacctctggc aatcctgcac cgtgtcgtca acaacgatcc ggacctctcc       720
     ggcgtcgccg aagacgacga agtactgcgc ggcgtcatcg agggctgtct gtgcaaggag       780
     cccgaggacc ggccctcccc gcagcagatc aaggacacgt tcggcgcgat cggttggcag       840
     ccgctcaccg gcgtcgcctg gcagcagccg ccgctcggcg tcgggctgcc gctcaccgcc       900
     ggcgacgcgg ccgacctgcc gacggtggcc atcgcgccga agcgcggcac caagcgggtc       960
     gcggtgatct ccgcggccac ggtcgccgcg ctcatcctgg ccaccatcgc ggtcgtcgag      1020
     gcgagcggcg gcggcaaggg gaacacagcg gcggacaccg cgcgcaccgg cggtccgacg      1080
     tccagctctc agcagaacgg aggcgctttc ccgtctaccg acacctcctc cggcagcacc      1140
     agttccagcg ggcagacgac gccgacgagt agcagtccac ctccgccgtc acaagcatcg      1200
     ggagcgccag tgcctcccgg cggcggcgcc ggcagcacag cgccgccgca aggcagctcc      1260
     cagctggtca ccgtctccgt tccgattacc cagggcaatg gaggaagcag tcagaagccc      1320
     gctccgacct cctcgcaccc gacgacacat ccttcgtcgg cacacacgac gtccgcagct      1380
     ccacccccgc cgccgaccca caacccgcct ggcccgatgg ttgcgggcga catcagcgtg      1440
     ctgatcccga actgggtcgg cgcggccacg gtgaacgtct cttggaaggc gcactccgac      1500
     gccacgagct acgccatcca ctacacggtc aagggaacgg cgaccaacag cgaccagacc      1560
     gtgccggtct cgggtaccag ctactcctac caaatcccgg ctgacgggac gacgtgcctc      1620
     caagtccgga cggtcaacca gtacggctcc tcggctttct acccgagccc gatgtactgc      1680
     gtgaactcgt tcggccaggt aagcagcggc ggatga                                1716
//

If you have problems or comments...

PBIL Back to PBIL home page