(data stored in ACNUC7421 zone)

EMBL: CP001700.PE9

CP001700.PE9         Location/Qualifiers
FT   CDS_pept        complement(13602..14144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0009"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rlt:Rleg2_4895 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68964"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFM5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU68964.1"
FT                   /translation="MSAVQIAGCSAAGKSAIATALAHQGLTTIDSDADPHLARFVDPQG
FT                   TIVAQPPPAPDLPWLAEHSWAWDPNRLDELIQTAAPATLYVCGGADNQHEMANRFTQVF
FT                   LLEIDEPTMLARLDARRDYHEWGHVGDTREYLRRKLPILQDTLRASGAIVIDARQPLDQ
FT                   VVAAVLRYTPPMAPFSF"
     atgagcgcag tccaaatcgc aggctgttcc gccgccggca aatccgccat agcaaccgca        60
     ctagcccacc aaggcctaac caccatcgac tccgacgccg acccccatct cgcaaggttc       120
     gtcgatcccc aaggcaccat cgtggcgcaa ccaccaccag cgccagacct accctggctc       180
     gccgaacaca gctgggcctg ggacccgaac cgcctagacg aactgatcca aacagcagca       240
     ccagcaacgc tctacgtctg cggcggcgcg gacaatcagc acgagatggc caaccgcttc       300
     acccaagtct tcctcctgga gatcgacgaa cccacaatgc tggcacgcct agacgcacgc       360
     cgcgattatc acgagtgggg ccacgtcgga gacacccgcg agtatctacg ccgaaagctc       420
     cccatactgc aggacacctt gcgcgcatca ggcgcaatcg tcatcgacgc cagacagccc       480
     ctcgaccagg tggtggccgc ggtactgcgg tacacgccgc cgatggcgcc attctctttc       540
     tga                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page