(data stored in ACNUC7421 zone)

EMBL: CP001700.PE90

CP001700.PE90        Location/Qualifiers
FT   CDS_pept        complement(93643..94437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0090"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: sma:SAV_4383 hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69045"
FT                   /db_xref="GOA:C7QHA6"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHA6"
FT                   /inference="protein motif:PFAM:PF00795"
FT                   /protein_id="ACU69045.1"
FT                   /translation="MRVSLMQLAVDDAEAPEDRWTRVVKLVEAERETGAELVVLPELWV
FT                   TGGFDYKSWTGHAEPIADSQPIAALEKVRTHDGSGPEMWLHFGSYVERTPEGILYNTAV
FT                   FRGPDGKQAQYRKIHRFGFSEGEVTLMGPGKDIVTVSSPWGTLGLATCYDLRFPELFRR
FT                   LLNQGMEHMVMCSAWPAKRIEHWRVLLKARAIENQVFVFATNCVGTNGGVALGGRSAVI
FT                   DPWGNVVAEAGTGEEVLRVDVDPALVAQTRSALPVLNDRRLR"
     atgcgcgtat cgctcatgca gctcgccgtc gacgacgcgg aagcgccgga ggaccgctgg        60
     acccgtgtgg tgaagctggt cgaagccgaa cgggagaccg gcgcggagct ggtcgtcctg       120
     cccgaactct gggtcaccgg cgggttcgac tacaagagct ggaccggtca tgccgaaccg       180
     atcgccgaca gccagccgat cgccgcgttg gagaaggtgc gcacccacga cggttcgggc       240
     cctgagatgt ggctgcactt cggttcttac gtagagcgca cacctgaggg gattctctat       300
     aacaccgcgg tgttccgcgg acccgacggc aagcaggcgc agtatcggaa gatccatcgg       360
     ttcggcttca gcgaaggcga agtgaccctg atgggacccg ggaaggacat cgtcaccgtc       420
     tcctccccat ggggaaccct ggggctggcc acctgttacg acctccgctt cccggagctg       480
     ttccgtcgcc tcctgaatca gggcatggag cacatggtga tgtgctctgc gtggcccgct       540
     aagcgaatcg agcactggcg ggttctcctt aaggcccgcg cgatcgagaa ccaggtgttc       600
     gtcttcgcca cgaactgtgt ggggacgaac ggaggcgtgg ctctcggcgg gcgttccgcc       660
     gtcatcgatc cctggggaaa tgtcgtcgcc gaagccggta ccggtgaaga ggtcctgcgg       720
     gtggacgtcg atccggcact ggtggcccag actcggagcg cgttgccagt tctcaacgac       780
     cgccgcctgc gctga                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page