(data stored in ACNUC7421 zone)

EMBL: CP001700.PE91

CP001700.PE91        Location/Qualifiers
FT   CDS_pept        complement(94534..96027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0091"
FT                   /product="catalytic domain of components of various
FT                   dehydrogenase complexes"
FT                   /note="PFAM: catalytic domain of components of various
FT                   dehydrogenase complexes; biotin/lipoyl attachment domain-
FT                   containing protein; E3 binding domain protein; KEGG:
FT                   sco:SCO3815 branched-chain alpha-keto acid dehydrogenase
FT                   subunit E2"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69046"
FT                   /db_xref="GOA:C7QHA7"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHA7"
FT                   /inference="protein motif:PFAM:PF00198"
FT                   /protein_id="ACU69046.1"
FT                   /translation="MGEIKRFNLPDVGEGLTEAEILAWSVKVGDLVKVNQVLVEIETAK
FT                   AAVELPSPWAGKIVELLVDEGQTVDVGTPIIGIDTDPSTPSTGGAGGDDMTAGVAATAE
FT                   AKAAPAAAKEPKEAKREPVLVGYGVKQGASSRRPRKTAAAPSAADVMGATVREEPVADE
FT                   VPAPAYYGQSAAREAAAPAVQTRTPDTTAAPAAPTGAKPLAKPPVRKLAKDLGVDLALV
FT                   VATGTNGTVTREDVHAAASGTSTAAAAPAAANGTAPAAAPFVNGERRVPIKGVRKATAT
FT                   AMVQSAFTAPHVTEFLTVDVTPTMKFVQRLKEMPDFKGVRVSPLLLVAKAFLVAMARNP
FT                   EINARWDEAAGEIVYFDHVTLGIAAATPRGLLVPNVKGADLLPLVELGRALNKLTDVAR
FT                   EGKTSLADMTGATATITNVGVFGVDTGTPILNPGEASILAFGAVREQPWMHKGKVKPRQ
FT                   VTTLALSFDHRLVDGELGSKVLRDIGAVLADPLTALAWS"
     atgggtgaga tcaagagatt caacctcccg gacgtcggcg aaggcctgac cgaggccgag        60
     atcctggcct ggtcggtgaa ggtcggcgac ctggtcaagg tcaaccaggt cctggtcgag       120
     atcgagaccg cgaaggcggc cgtcgagctg ccctcgccgt gggccggcaa gatcgtcgag       180
     ctgctggtgg acgaggggca gacggtcgac gtcggcaccc cgatcatcgg gatcgacacc       240
     gacccgagca cgccgagcac cggcggcgcg ggcggggacg acatgaccgc cggcgtcgcg       300
     gccaccgccg aggcgaaggc cgcgccggcc gccgccaagg agcccaagga agccaagcgc       360
     gagccggtcc tggtcggcta cggcgtgaag cagggcgcct ccagccgccg tccgcgcaag       420
     acggcggcgg cgccgtcggc agccgacgtc atgggtgcca cggtccgcga ggagccagtc       480
     gccgacgagg tcccggctcc ggcctactac ggccagtccg cggcgcggga ggcggccgct       540
     ccggcggtcc agacccgcac gccggacacc acggccgcac cggccgcacc gaccggcgcg       600
     aagccgctgg ccaagccgcc ggtccgcaag ctggccaagg acctcggcgt cgatctggca       660
     ctggtggtcg cgaccggtac caacggcacg gtgacccggg aggacgtcca cgcggcggcc       720
     tccgggacgt cgaccgccgc tgcggcgccg gctgccgcca acggcactgc cccggccgcc       780
     gcgcccttcg tcaacggcga gcgccgcgtc ccgatcaagg gcgtgcgcaa ggcgaccgcc       840
     acggcgatgg tgcagtcggc gttcaccgcg ccgcacgtca ccgagttcct gacggtcgac       900
     gtcaccccga ccatgaagtt cgtgcagcgc ctcaaggaga tgccggactt caagggcgtg       960
     cgggtgtcgc cgctgctgct ggtcgccaag gcgttcctgg tggcgatggc gcggaacccg      1020
     gagatcaacg cgcgctggga cgaggcggcc ggcgagatcg tctacttcga ccacgtcacc      1080
     ttgggcatcg cggcggccac gccgcgcggg ctgctggtgc cgaacgtcaa gggcgccgac      1140
     ctgctgccgc tggtggagct gggccgcgcg ctcaacaagc tcaccgacgt ggcacgcgag      1200
     ggcaagacct cgctggcgga catgaccggc gccacggcga cgatcaccaa cgtcggcgtc      1260
     ttcggtgtgg acaccggcac cccgatcctc aaccccggcg aggcgtcgat cctggcgttc      1320
     ggcgcggtgc gggaacagcc gtggatgcac aagggcaagg tgaagccgcg ccaggtgacc      1380
     acgctcgcgc tgtccttcga ccaccgcctg gtcgacggcg agctgggttc gaaggtgctg      1440
     cgggacatcg gtgcggtcct cgcggacccg ctgaccgcgc tcgcctggag ctga            1494
//

If you have problems or comments...

PBIL Back to PBIL home page