(data stored in ACNUC7421 zone)

EMBL: CP001700.PE92

CP001700.PE92        Location/Qualifiers
FT   CDS_pept        complement(96046..97041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0092"
FT                   /product="Transketolase central region"
FT                   /note="PFAM: Transketolase central region; Transketolase
FT                   domain protein; KEGG: sco:SCO3816 branched-chain alpha keto
FT                   acid dehydrogenase E1 beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69047"
FT                   /db_xref="GOA:C7QHA8"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHA8"
FT                   /inference="protein motif:PFAM:PF02779"
FT                   /protein_id="ACU69047.1"
FT                   /translation="MAESTSKTQQISLGKGLNLGLRRALEDDPKVLLMGEDIGKLGGVF
FT                   RVTDGLQKDFGDSRVIDTPLAESGIVGTAVGLALSGYRPVVEIQFDGFVYPAFDQIVTQ
FT                   VAKMRARALGTVSMPIVIRIPFGGGIGAVEHHSESPEGYFAMTAGLRVVAASNPVDAYW
FT                   MIQQAIASDDPVVFFEPKRRYWDKAELDPAATPYPLYASRVVREGTDATLVAYGPMVKT
FT                   CLEAAAAAAEEGRSLEVIDLRTLSPLDLEPVYASVRKTGRLITVHEASVFMGMGAEVAA
FT                   KVTEKCFYSLEAPVLRVGAPHTPYPPSRVEEEFLPDLDRVLDAVDRAFAF"
     atggcagagt cgacttccaa gacacagcag atcagcctcg gcaagggctt gaacctgggc        60
     cttcgccggg ccctggagga cgacccgaag gtcctgctca tgggcgagga catcggcaag       120
     ctcggcggcg tcttccgcgt caccgacggc ctgcagaagg acttcggcga ctcgcgggtc       180
     atcgacaccc cgctggccga gtccggcatc gtgggcaccg cggtcggcct ggccctgtcc       240
     ggctaccggc cggtggtgga gatccagttc gacggcttcg tctacccggc cttcgaccag       300
     atcgtcaccc aggtcgccaa gatgcgcgcc cgcgcgctgg gcacggtcag catgccgatc       360
     gtgatccgca tcccgttcgg cggcggcatc ggcgcggtcg agcaccactc ggagtccccc       420
     gaggggtact tcgccatgac cgccgggctg cgcgtggtcg ccgcgtccaa cccggtggac       480
     gcctactgga tgatccagca ggccatcgcc tccgacgacc cggtcgtgtt cttcgagccc       540
     aagcgccgct actgggacaa ggccgagctg gacccggccg cgaccccgta cccgctctac       600
     gcctcccgcg tcgtgcgcga ggggacggac gcgacgctgg tcgcctacgg cccgatggtg       660
     aagacctgcc tggaggccgc cgcggcagcc gcggaggagg gccgctcgct ggaggtcatc       720
     gacctgcgca cgctgtcccc gctggacctg gagccggtct acgcctcggt gcgcaagacc       780
     ggtcgcctca tcaccgtgca cgaggcctcg gtcttcatgg ggatgggcgc cgaggtcgcg       840
     gcgaaggtca ccgagaagtg cttctactcc ctggaggcac cggtcctgcg cgtcggcgcc       900
     ccgcacaccc cgtatccgcc atcgcgggtc gaggaggagt tcctgccgga cctggaccga       960
     gtgctggacg ccgtcgaccg cgcgttcgcg ttctga                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page