(data stored in ACNUC7421 zone)

EMBL: CP001700.PE93

CP001700.PE93        Location/Qualifiers
FT   CDS_pept        complement(97043..98170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0093"
FT                   /product="pyruvate dehydrogenase (acetyl-transferring) E1
FT                   component, alpha subunit"
FT                   /EC_number="1.2.4.1"
FT                   /note="KEGG: sgr:SGR_3765 putative branched-chain alpha
FT                   keto acid dehydrogenase E1 alpha subunit; TIGRFAM: pyruvate
FT                   dehydrogenase (acetyl- transferring) E1 component, alpha
FT                   subunit; PFAM: dehydrogenase E1 component"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69048"
FT                   /db_xref="GOA:C7QHA9"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017596"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHA9"
FT                   /inference="protein motif:TFAM:TIGR03181"
FT                   /protein_id="ACU69048.1"
FT                   /translation="MVTSRKGAGGKTAAKKKAGPADPDLVQLLTPDGDLVEHPEYSIDL
FT                   TPEEYRGLYRDMVLVRRIDAEGTALQRQGELGLWAPLLGQEAAQVGSGRAQTAEDYAFP
FT                   TYREHGVAWCRDVDPVNLLGMFRGVNNGGWDPNEKNFHLYTIVIGSQTLHATGYAMGMQ
FT                   RDGREAAVIAYFGDGASSQGDVNEAFVFASVNNAPVVFFCQNNQWAISEPNERQFRVPL
FT                   YQRAAGFGFPGVRVDGNDVLACLAVTRAALERARTGNGPMLVEAFTYRMGAHTTSDDPT
FT                   RYRSSDELEEWKAKDPILRMRAFLEKSKYADEAFFKEVDTEADTVAADIRERCVTMPDP
FT                   KPISIFDHVYAEPHPLMDEERAEYGAYWESFEGAH"
     gtggtgacct cacgcaaggg cgcgggtgga aagaccgctg ctaagaagaa ggccggtccc        60
     gcggacccgg acctcgtgca gctgctgaca cccgacgggg atctggtcga gcaccccgag       120
     tactcgatcg acctgacgcc cgaggagtat cgcggcctgt accgggacat ggtcctggtc       180
     cgccgcatcg acgccgaagg cacggcgctg cagcgccagg gcgagctggg gctgtgggcc       240
     ccgctgctgg gccaggaggc cgcgcaggtc ggctccggcc gcgcgcagac cgccgaggac       300
     tatgccttcc ccacctaccg cgagcacggt gtggcctggt gccgcgacgt ggacccggtg       360
     aacctgctcg ggatgttccg cggcgtgaac aacggcggct gggacccgaa cgagaagaac       420
     ttccacctct acacgatcgt gatcggctcc cagacgctgc acgccaccgg ctacgccatg       480
     ggcatgcagc gcgacggccg cgaggccgcg gtgatcgcgt acttcggcga cggcgcgtcc       540
     tcgcagggcg acgtcaacga ggcgttcgtc ttcgccagcg tgaacaacgc gcctgtggtg       600
     ttcttctgcc agaacaacca gtgggccatc tccgagccca acgagcgcca gttccgcgtg       660
     ccgctgtacc agcgcgccgc cggcttcggc ttcccgggtg tccgcgtgga cggcaacgac       720
     gtcctggcgt gcctggccgt caccagggcc gccctggaac gcgcccggac cggcaacggc       780
     ccgatgctgg tcgaggcgtt cacctaccgc atgggggcgc acaccacctc cgacgacccg       840
     acccgctacc gcagctccga cgagctggag gagtggaagg ccaaggaccc gatcctgcgt       900
     atgcgggcgt tcctggagaa gagcaagtac gccgacgagg cgttcttcaa ggaggtcgac       960
     accgaggcgg acaccgtcgc ggccgacatc cgcgagcgct gcgtcacgat gccggacccg      1020
     aagccgatct cgatcttcga ccacgtctac gccgagccgc accccctgat ggacgaggaa      1080
     cgcgcagagt acggggctta ctgggaatct ttcgagggtg ctcactga                   1128
//

If you have problems or comments...

PBIL Back to PBIL home page