(data stored in ACNUC7421 zone)

EMBL: CP001700.PE94

CP001700.PE94        Location/Qualifiers
FT   CDS_pept        98378..99079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0094"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; Sigma-70 region 4 type 2; SMART: response
FT                   regulator receiver; regulatory protein LuxR; KEGG:
FT                   ace:Acel_0518 two component LuxR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69049"
FT                   /db_xref="GOA:C7QHB0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHB0"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACU69049.1"
FT                   /translation="MHSDAGKPGIPDSIRVFLLDDHELVRRGVAEMLSAEPDIDVTGQA
FT                   GSVAQTVAAAEAARPDVALLDVRLPDGSGIEVCRELKSRMPGLGCLMLTSFSDDDALFG
FT                   AIMAGAAGYVLKDIRGSALVDAVRTVARGGSLLDPTATEKLLSRLRVGIVPGEADREAA
FT                   ASKLATLTVSEKRILELIAEGLTNRQIGERLNLAEKTVKNYITGILAKLAMQRRTQAAA
FT                   FAVRHLPGRSQ"
     gtgcactctg atgcggggaa accgggcata ccggactcga tccgggtctt cctgctggac        60
     gaccacgagt tggtgcggcg cggggtcgcc gaaatgctga gcgccgagcc cgacatcgac       120
     gtgaccggtc aggccggcag tgtggcgcag acggtggccg cggccgaggc ggcgcggccg       180
     gacgtcgccc tgctggacgt gcggcttccc gacggatcgg gcatcgaggt ctgccgcgag       240
     ctgaagtcgc ggatgcccgg tctgggctgc ctgatgctga cctctttctc cgacgacgac       300
     gcgctgttcg gcgcgatcat ggccggcgcc gcgggctacg tgttgaagga catccggggc       360
     tcggcgctcg tcgacgcggt ccggacggtg gcgcgcggtg gctcattgct ggacccgacc       420
     gccacggaga agctgctgag caggctgcgc gtcgggatcg tgcccgggga ggccgatcgc       480
     gaggcagcgg cgtcgaaact ggcgacgctg acggtgtcgg agaagcggat tctggagctg       540
     atcgccgagg gtctcaccaa ccgccagatc ggcgagcggc tgaacctggc cgagaagacg       600
     gtgaagaact acatcaccgg gatcttggcg aagctggcga tgcagcggcg cactcaggct       660
     gccgcgttcg ctgtacgaca tcttcctggg cgttcgcagt ag                          702
//

If you have problems or comments...

PBIL Back to PBIL home page