(data stored in ACNUC7421 zone)

EMBL: CP001700.PE95

CP001700.PE95        Location/Qualifiers
FT   CDS_pept        complement(99127..99723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0095"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: sco:SCO1339
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69050"
FT                   /db_xref="GOA:C7QHB1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041583"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHB1"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACU69050.1"
FT                   /translation="MTSRPDLIGDTAIALLAERGLRGLTHRAVDEAAGLPPGSTSNHAR
FT                   TRSALLETTFARLCRLEAEIFEDAANPGGLLALATLTPETAADLVAAQLHDTLTHRREQ
FT                   ALARFELALEATRRPELRAIYDTAGATFREPARGLMAALGATDPDRAGRSFIAFSEGIL
FT                   FDSVAGAGSRKVPTQEEIRDDLLELFRGMLMEPSP"
     atgacctccc gtcccgacct catcggagac accgcgatcg ccctgctcgc cgagcgggga        60
     ctgcgcgggc tcacccaccg cgccgtcgat gaggccgcgg gcctgccgcc cggctccacc       120
     tccaaccacg cccggacccg cagcgcccta ttggagacga cgttcgcccg gctgtgccgc       180
     ttggaagccg agatcttcga ggacgcggcg aaccccggcg gcctgctcgc tctggcgacg       240
     ctgacgccgg agaccgccgc cgatctggtg gccgctcagc tccacgacac cctcacgcac       300
     cgccgggagc aggcgctggc gcgcttcgag ctggctctgg aggcgaccag gcgccccgaa       360
     ctgcgcgcca tctacgacac cgcgggagcg accttccgag agcccgcacg aggcctcatg       420
     gcggctctcg gcgccaccga cccggaccga gccggccgca gcttcatcgc gttcagcgaa       480
     gggatcctgt tcgactcggt cgccggcgcc ggcagccgaa aagtcccgac ccaagaggag       540
     atccgcgatg acctcctgga gctctttagg ggaatgctca tggagccctc gccatag          597
//

If you have problems or comments...

PBIL Back to PBIL home page