(data stored in ACNUC7421 zone)

EMBL: CP001700.PE96

CP001700.PE96        Location/Qualifiers
FT   CDS_pept        99812..100978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0096"
FT                   /product="monooxygenase FAD-binding"
FT                   /note="PFAM: monooxygenase FAD-binding; KEGG: sco:SCO1338
FT                   monooxygenase (secreted protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69051"
FT                   /db_xref="GOA:C7QHB2"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHB2"
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /protein_id="ACU69051.1"
FT                   /translation="MEAIVVGAGFGGLTAAVGLFQRGWDVTVVERATELRPVGSGLAVA
FT                   PNGLRALDTLGVGDAVRKLAAFQGDATVTRPDGRVIARTASKAIVRRFGDAVIPATRSS
FT                   VMDVLTALVPADVFRLGVAAQGVEAGSASQRPCLLTDSGRLEADMIVAADGVNSVLRRA
FT                   LFPEHPGAVYSGITAWRLLVPTPAGDFLPGEVWGGGRVFGITPLADGRTYAYGADHAEP
FT                   GITYPDEKAELLRRFGDWHFPIPALISGADPETVLHNDIYEIAEALPAYHRGSVAILGD
FT                   AAHAMTPHLGQGANQAMEDGVTLAALVGPAKDSEEIASALARYTALRALRGADMVRRSH
FT                   RMGALTQSTSRSKTALRNLGMSLVGRLVPDLALRAMEPVVAWRPPEGP"
     atggaagcga tcgtggtggg ggcggggttc ggcgggctca ctgcggcggt ggggctgttc        60
     cagcgcgggt gggacgtcac ggtggtcgag cgcgccacgg agctgcgacc tgtgggttcc       120
     ggcctggctg ttgcgccgaa cgggttgcgg gcgctggaca cgctgggggt cggcgacgcg       180
     gtgcggaaac tggcggcgtt tcagggggac gccacggtga cccgccccga cggccgggtg       240
     atcgcgcgca cggcgagcaa ggccatcgtc cgccggttcg gcgatgcggt gatcccggcg       300
     acgcggtctt ccgtcatgga cgtgctcacg gcgttagtac ctgcggacgt gttccgactt       360
     ggagtcgcgg ctcagggggt cgaggccgga agtgcttctc agcggccgtg cctgctgacg       420
     gattccggtc gcctcgaagc ggacatgatc gttgcggccg acggagtgaa ctccgtactg       480
     cgcagggctc tgttcccgga acatccagga gccgtctata gcggcatcac cgcgtggcgg       540
     ctcctcgtac cgactcctgc gggtgacttc ctgcctggcg aggtctgggg aggtggccgg       600
     gtcttcggga tcacgccgct ggccgatggc cgtacctatg cctacggcgc cgatcacgcg       660
     gaacccggaa tcacctaccc ggatgagaag gccgagctgc tgcggcgctt tggtgattgg       720
     cacttcccga tcccggcgtt gatctccggt gcggatcccg aaacggtcct gcataacgac       780
     atctacgaga tcgccgaagc gttgcccgcc tatcaccgag ggtcggtcgc gatcctgggc       840
     gatgccgcgc acgccatgac gccgcaccta ggtcagggag cgaatcaggc catggaggat       900
     ggcgtcacgc tggcggctct agtgggaccg gctaaggact ctgaggagat cgccagtgcg       960
     ctcgcgcggt acaccgcact gcgggcactg cgaggtgcgg acatggtgcg ccggtcgcat      1020
     cgcatgggcg cgctgaccca gagcacatca cggtccaaga cggcactgcg aaacctgggg      1080
     atgagcctcg tcggacggct tgtgccggac ctggcactgc gagcgatgga gccggtggtc      1140
     gcgtggcggc caccggaggg accgtag                                          1167
//

If you have problems or comments...

PBIL Back to PBIL home page