(data stored in ACNUC7421 zone)

EMBL: CP001700.PE97

CP001700.PE97        Location/Qualifiers
FT   CDS_pept        100989..101933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0097"
FT                   /product="Prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /note="PFAM: prephenate dehydratase; amino acid-binding ACT
FT                   domain protein; KEGG: ace:Acel_2105 prephenate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69052"
FT                   /db_xref="GOA:C7QHB3"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHB3"
FT                   /inference="protein motif:PRIAM:4.2.1.51"
FT                   /protein_id="ACU69052.1"
FT                   /translation="MTDTASPRVPTRYGFLGPAGTFTEAALLSVPGARDAERVPYESVP
FT                   AALDAVRRDEVAGAVVAFENSVEGAVPATLDDLSTEEPPLHIVREILLPVEFALMGRPD
FT                   TALADIKTVSSHPHAYPQCRRWLAENLPDARWVAASSNADAARLVSEGVHDAALAGSFA
FT                   APFYRLTLLAENIHDVSGAVTRFVMVVPPGPPPARTGADKTSLAVVLRDNHPGALLEIL
FT                   EEFAVRGVDLMRIESRPTRSKLGTYWFSIDCEGHLEDARVGEVLTGLRRVAAEVRYLGS
FT                   YPRADGRAAEIRKGTSDEDFHEAAEWLAGLRNR"
     atgaccgata ctgcgtcgcc tcgcgtcccc actcgctacg gcttcctggg cccggcgggg        60
     acgtttacgg aggcggcgct tcttagcgtt cccggcgcgc gggacgcgga gcgggttcca       120
     tatgagtccg tgccggcagc gctggacgcg gtgcggcgtg acgaggtggc gggcgcggtt       180
     gtcgcgttcg agaactccgt cgagggcgca gtgccggcaa cgcttgacga tctctccact       240
     gaggaaccgc cgctgcacat cgtgcgcgag atcctgttgc cggtggagtt cgcgctcatg       300
     gggcgcccgg acacggcgct cgccgacatc aagaccgtct ccagccatcc gcacgcctat       360
     ccgcagtgcc ggcggtggct ggccgagaat ctgccggacg cgcggtgggt cgcggcgtcg       420
     tccaacgcgg acgcggcgcg gctggtctcc gagggcgtgc acgacgccgc cctggcgggg       480
     tccttcgcgg cgccgttcta ccggctcacg ctgctcgccg agaacatcca cgacgtcagc       540
     ggggcggtca cccggttcgt gatggtcgtg ccgcccggcc cgccgccggc ccggaccggc       600
     gccgacaaga cgtccctggc cgtggtgctg cgggacaacc acccgggcgc gctcctggag       660
     atccttgagg agttcgcggt ccggggcgtg gacctgatgc gcatcgagtc gcgcccgacg       720
     cggtcgaagc tggggaccta ctggttctcc atcgactgcg aagggcacct ggaggacgcg       780
     cgggtcgggg aagtcctgac cggcctgcgg cgggtcgccg ccgaggtccg gtacctcggc       840
     agctacccgc gtgccgacgg gcgcgccgcg gagatccgca aagggacctc cgacgaggac       900
     ttccacgagg cggccgaatg gctggccggc ctcaggaacc gatga                       945
//

If you have problems or comments...

PBIL Back to PBIL home page