(data stored in ACNUC7421 zone)

EMBL: CP001700.PE98

CP001700.PE98        Location/Qualifiers
FT   CDS_pept        complement(101920..102750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0098"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV_4347 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69053"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHB4"
FT                   /inference="similar to AA sequence:KEGG:SAV_4347"
FT                   /protein_id="ACU69053.1"
FT                   /translation="METAQAMSEPLFQNLEDAVVVAETALLDTQVAVESLRAELDQFTR
FT                   LHQIQLGPLYGRLDELDALTAETEAAMTGDPEAIRRAVEARARVDGEDPMLFAAANAGL
FT                   LEDDGEGGSEHEQKPPRPREEAAPTPDPDVPVRPSKTAQRLYRELARRSHPDLVQDQAE
FT                   IARRSAFITRVNAAYEKDDLPALQKLSEEWSLTSSGPAVDSPQREMWLQHRLIWLRVKQ
FT                   AELALERQTLMENPMADVLAAYQYDSLTALRSISEQLYTAIAERETLLNALIGS"
     gtggagactg cccaggcaat gagtgagccg ttgttccaga atctggaaga cgccgtcgtg        60
     gtggccgaga cggccctgct ggacacgcag gtggccgtcg agtcgctgcg tgccgagttg       120
     gaccagttca cccggctgca ccagatccaa ctgggccccc tgtacggccg gctggacgag       180
     ctggacgcgc tcaccgccga gaccgaagcc gccatgaccg gcgaccccga ggccatccgc       240
     cgtgcggtgg aggcccgggc gcgggtcgat ggcgaggacc cgatgctgtt cgccgccgcg       300
     aacgccgggc tgctcgagga cgacggggag ggcggctccg agcacgagca gaagccgccg       360
     cgtcctcgcg aggaggcggc cccgaccccc gacccggacg tcccggtgcg cccgagcaag       420
     accgcgcagc ggctctaccg cgagctggcg cgccggtcgc acccggacct cgtccaggac       480
     caggccgaga tcgcccgccg ctcggcgttc atcacccgcg tcaacgccgc ctacgagaag       540
     gacgacctgc cggcgctcca gaagctcagc gaagaatggt cgctgacctc ctcgggcccg       600
     gcggtggaca gtccgcagcg cgagatgtgg ctccagcacc gcctgatctg gctgcgcgtg       660
     aagcaggcag agctggcact ggagcgccag acgctgatgg agaaccccat ggcggacgtg       720
     ctcgcggcct accagtacga ctcgctgacg gcgctgcgct cgatctccga gcagctctac       780
     acggcgatcg ccgagcggga gaccctgctg aacgcgctca tcggttcctg a                831
//

If you have problems or comments...

PBIL Back to PBIL home page