(data stored in ACNUC7421 zone)

EMBL: CP001700.PE99

CP001700.PE99        Location/Qualifiers
FT   CDS_pept        102850..103614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0099"
FT                   /product="LamB/YcsF family protein"
FT                   /note="PFAM: LamB/YcsF family protein; KEGG: fal:FRAAL4906
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69054"
FT                   /db_xref="GOA:C7QHB5"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHB5"
FT                   /inference="protein motif:PFAM:PF03746"
FT                   /protein_id="ACU69054.1"
FT                   /translation="MIDLNADLGEGFGRWRLGDDDALLELVTSANVACGFHAGDPSTMR
FT                   RVCAAAVSRGVRVGAQVGYRDLAGFGRRDIEYDPHELADDVLFQIGALDAFARAAGDRV
FT                   RYVKPHGALYNRIVHDAVQAEAVVRAVVTFASVYDVQVPVLGLPGSVFLELATTAGLSV
FT                   IPEAFADRAYTPQGTLVSRSKPGAVLTTPEEVAGRAVEMAVSGTVRAIDGTLVNVSARS
FT                   LCVHGDSPSAVAMAAAVRDGLRSVGVEVGAFA"
     atgatcgacc ttaacgcaga tctgggcgaa ggtttcgggc gttggcgact aggcgacgac        60
     gacgctctcc tggaactggt caccagtgcc aacgtcgcct gcggcttcca cgccggcgat       120
     ccctccacca tgcgccgggt ctgtgcggcg gctgtcagcc gcggagtacg ggtcggagcc       180
     caggtcggct accgtgacct ggccggattc ggccgccgcg acatcgagta cgacccccac       240
     gaactggccg acgacgtcct cttccagatc ggagccctgg acgccttcgc cagagcggcc       300
     ggtgaccgcg tccgctacgt gaaaccgcac ggggctctgt acaaccgtat cgtgcatgac       360
     gccgtacagg cggaggcggt ggtgcgagcg gtggtcacat tcgcttcagt gtacgacgtc       420
     caagtccctg tgttgggact tcccggatcc gtctttctgg aattggcgac cacggcaggc       480
     ctgtcggtca tccccgaagc cttcgccgac cgcgcctaca cgccccaggg gaccctggtc       540
     tcgcgctcca agcccggcgc ggtactgacg acaccggagg aagtcgcggg gcgcgcggtg       600
     gagatggccg tgtccggcac ggtccgcgcg atcgacggaa cgctggtgaa cgtgtcggcg       660
     cggtctttgt gcgtccacgg ggactcgccg tccgcggtgg ccatggcggc tgcggtgcgc       720
     gacgggctgc ggtcggtggg agtcgaggtc ggggcgttcg cgtga                       765
//

If you have problems or comments...

PBIL Back to PBIL home page