(data stored in ACNUC7421 zone)

EMBL: CP001720.PE101

CP001720.PE101       Location/Qualifiers
FT   CDS_pept        111772..112107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0103"
FT                   /product="protein of unknown function DUF972"
FT                   /note="PFAM: protein of unknown function DUF972; KEGG:
FT                   bsu:BSU00330 DNA replication intiation control protein
FT                   YabA"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61066"
FT                   /db_xref="GOA:C8W2R0"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2R0"
FT                   /inference="protein motif:PFAM:PF06156"
FT                   /protein_id="ACV61066.1"
FT                   /translation="MLSLAQLMKRSQEKLQELSRDIQELSVRVYALEEENANLRRELAL
FT                   SCYNSEQVNNSAAGDREDVGIGLKNLITIYDRGFHICNLSFGLERSNDCLFCQALLQKS
FT                   GAEQKNT"
     ttgctgtccc tggcccaatt aatgaaaaga tctcaggaga aattacagga actgtcacga        60
     gatattcaag aattatcagt aagagtatat gcccttgagg aggaaaatgc taatttacgg       120
     cgtgaattgg cacttagctg ttataacagt gaacaggtaa ataatagtgc agccggtgat       180
     cgggaggatg ttgggattgg cttaaaaaat ttgatcacaa tatatgatag gggttttcat       240
     atttgcaatc tttcctttgg attggaaaga tccaatgact gtcttttttg tcaggcgctt       300
     ttgcaaaaaa gcggtgcgga gcaaaagaat acataa                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page