(data stored in ACNUC7421 zone)

EMBL: CP001720.PE103

CP001720.PE103       Location/Qualifiers
FT   CDS_pept        complement(113089..113349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0105"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="TIGRFAM: transcriptional regulator, AbrB family;
FT                   PFAM: SpoVT/AbrB domain protein; KEGG: bsu:BSU00370
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61068"
FT                   /db_xref="GOA:C8W2R2"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2R2"
FT                   /inference="protein motif:TFAM:TIGR01439"
FT                   /protein_id="ACV61068.1"
FT                   /translation="MKSTGIVRKVDELGRVVIPIELRRTLGIDEKDALEIYVDHEKIIL
FT                   KKYEPACVFCHNASDVQHYKGKLVCRECATAMFENVKDQAI"
     ttgaaatcta caggtatagt aagaaaagtt gatgagttgg gacgggtggt aatccccata        60
     gaattgcgtc gaaccttagg tatcgatgaa aaagacgcat tggagatcta tgtggatcat       120
     gaaaaaataa ttctgaaaaa atatgaaccg gcctgcgtat tttgtcataa tgcttcagat       180
     gtgcagcatt ataaaggcaa gcttgtctgc cgcgagtgcg ctactgctat gtttgaaaat       240
     gtaaaagatc aagctatata a                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page