(data stored in ACNUC7421 zone)

EMBL: CP001720.PE105

CP001720.PE105       Location/Qualifiers
FT   CDS_pept        115808..116578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0107"
FT                   /product="hydrolase, TatD family"
FT                   /note="TIGRFAM: hydrolase, TatD family; PFAM: TatD-related
FT                   deoxyribonuclease; KEGG: baa:BA_0627 TatD related DNase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61070"
FT                   /db_xref="GOA:C8W2R4"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2R4"
FT                   /inference="protein motif:TFAM:TIGR00010"
FT                   /protein_id="ACV61070.1"
FT                   /translation="MLIDTHAHLDHQKFEQDRDEVIARAGTAGVVKIINAAGDIESSLA
FT                   GIELARQHSGIYAAVGIHPHDAKDAPEDYLDQLFELAHREKVVAIGEIGLDYYYDFSPR
FT                   QIQQQIFRAQLELCKKVNLPVIIHNRDAHKDVLDMLQEVGIGPAGGVMHCFSGSWEVAQ
FT                   QCIKLGLNISFAGPVTFQNAGKLKDVAARVPMDKILAETDCPYLTPHPHRGKRNEPAHV
FT                   GLVVQQIAELKGLSYEEAAAIIYNNAIKLFALED"
     atgcttattg atacccatgc tcacttggac caccagaagt ttgagcagga cagggacgaa        60
     gttatagcca gagcgggtac tgccggggtg gtaaaaatta taaatgcagc cggcgatatt       120
     gagtcttctc tggccggtat cgagctggcg agacaacatt ccgggattta cgctgcggta       180
     ggaatacatc ctcatgatgc aaaagatgct cctgaggatt acctggacca attgtttgag       240
     ctggcccaca gagaaaaagt agtggctatc ggagaaattg gtttggatta ttactatgac       300
     ttttctccaa gacagataca gcagcaaata tttcgggctc aactggagct atgtaaaaag       360
     gtaaatttac ctgtaattat tcataaccgg gacgcacata aagatgtcct ggatatgctg       420
     caggaggttg gaataggtcc tgcaggtgga gtgatgcatt gtttttccgg cagttgggaa       480
     gtggcacagc aatgtataaa gttgggtctt aatatttctt ttgccgggcc tgtgaccttt       540
     caaaatgccg gcaagcttaa agatgtggct gccagggttc ccatggataa aattttagca       600
     gaaaccgatt gcccttatct gacgcctcat ccgcaccggg gcaagagaaa tgaacctgct       660
     cacgtaggcc tggtagtaca gcaaattgcc gaattaaaag gtcttagtta tgaggaggcg       720
     gcagcaatca tttataataa tgcaataaaa ttatttgctt tggaggatta g                771
//

If you have problems or comments...

PBIL Back to PBIL home page