(data stored in ACNUC7421 zone)

EMBL: CP001720.PE106

CP001720.PE106       Location/Qualifiers
FT   CDS_pept        116606..117145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0108"
FT                   /product="cob(I)alamin adenosyltransferase"
FT                   /EC_number="2.5.1.17"
FT                   /note="KEGG: scl:sce0214 cob(I)yrinic acid a,c-diamide
FT                   adenosyltransferase; TIGRFAM: cob(I)alamin
FT                   adenosyltransferase; PFAM: ATP:corrinoid
FT                   adenosyltransferase BtuR/CobO/CobP"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61071"
FT                   /db_xref="GOA:C8W2R5"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2R5"
FT                   /inference="protein motif:TFAM:TIGR00708"
FT                   /protein_id="ACV61071.1"
FT                   /translation="MSEKNARGLIMTFTGNGKGKTTAALGMALRALGQGMRVIVLQFIK
FT                   GGREYGELLMEEKLGPNFEIRQMGLGFVRNLSEQQKEQHKQAAIEALGLAAQIIGSDKY
FT                   RMVILDEVFYGIKYGFFTISDLLELLRSKPYDLHLVLTGRDAPEEIIVLSDLVTEMKEI
FT                   KHPYKQGIVAQKGVEF"
     gtgtctgaaa aaaacgccag agggttaatt atgactttta ccggtaacgg taagggaaag        60
     accaccgctg ccctgggcat ggctttacga gccctgggcc agggtatgag ggtaattgta       120
     ttgcagttta tcaagggtgg cagagagtac ggcgaattac ttatggagga aaagctcggt       180
     ccaaattttg aaataaggca aatgggtttg ggttttgttc ggaacttatc cgagcaacaa       240
     aaggagcagc ataaacaggc agctattgaa gcattggggt tggctgctca gataattggt       300
     tccgacaaat accgtatggt tattttagac gaagtttttt acggcataaa gtatggtttt       360
     tttacaatct cagatttgct ggaattattg cggagtaagc cttatgattt gcatttagta       420
     ctgacaggcc gggacgcgcc ggaagaaata atcgtattaa gtgacctcgt aacagaaatg       480
     aaggaaatta aacaccctta caagcagggt atagttgctc agaaaggagt cgaattctaa       540
//

If you have problems or comments...

PBIL Back to PBIL home page